xoxSamIAmxox
PM . Follow . Favorite
Joined 10-03-09, id: 2103079, Profile Updated: 12-23-12
Sort: Category . Published . Updated . Title . Words . Chapters . Reviews . Status .

The Wild Man's Journey by TheForceIsStrongWithThisOne reviews
Beast Boy encounters a stranger who lives inside him and who causes him to change. 150,000 views! Thanks to all my readers! I couldn't have done it without you!
Teen Titans - Rated: T - English - Adventure/Romance - Chapters: 44 - Words: 152,226 - Reviews: 713 - Favs: 404 - Follows: 182 - Updated: 5/13/2017 - Published: 1/2/2010 - [Beast Boy, Raven] Terra - Complete
When All Else Fails by HappinessIsntAFishYouCanCatch reviews
Rachel and Kurt are kidnapped by a man seeking revenge on the Andersons. It's up to Blaine to make the right moves before it's too late. Klaine, Kurtchel Friendship. FINALLY UPDATED AFTER LONG HIATUS AND WILL BE FINISHED
Glee - Rated: T - English - Drama/Suspense - Chapters: 9 - Words: 53,752 - Reviews: 111 - Favs: 118 - Follows: 188 - Updated: 3/19/2017 - Published: 4/28/2011 - Rachel B., Kurt H., Finn H., Blaine A.
Prince Charming by LilVampireKitten reviews
Blaine was Kurt's Prince Charming, what he didn't realise was he wasn't just his. Prince!Blaine. KLAINE! Rating for safety reasons for later chapters
Glee - Rated: M - English - Romance/Drama - Chapters: 72 - Words: 289,910 - Reviews: 994 - Favs: 734 - Follows: 577 - Updated: 11/26/2016 - Published: 8/13/2011 - Kurt H., Blaine A. - Complete
iAm At Home On The Ranch by BeautifulDreamer.x reviews
Sam Puckett has a huge secret, a secret that comes out when she, Freddie and Carly go to her Aunt Amanda's horse farm. Will the death of one of the horses bring a certain tech geek and a certain blonde haired bully closer together? Sam/Freddie.
iCarly - Rated: T - English - Romance - Chapters: 40 - Words: 78,464 - Reviews: 249 - Favs: 121 - Follows: 67 - Updated: 7/6/2016 - Published: 10/4/2009 - Freddie B., Sam P. - Complete
iJust Saw Sam Naked by Jesus.Lives reviews
And Lived to Tell The Tale. A companion fic to 'iJust Saw Freddie Naked'. I wonder who I feel more sorry for... Sam or Freddie. FINALLY COMPLETE!
iCarly - Rated: T - English - Humor/Romance - Chapters: 22 - Words: 7,790 - Reviews: 398 - Favs: 144 - Follows: 45 - Updated: 12/29/2015 - Published: 12/3/2007 - Freddie B., Sam P. - Complete
iJust Saw Freddie Naked by Jesus.Lives reviews
What happens when Sam just happens to catch Freddie in the shower? CHAP 16. The end. So SEDDIE it hurts.
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 17 - Words: 6,802 - Reviews: 170 - Favs: 127 - Follows: 28 - Updated: 12/29/2015 - Published: 11/23/2007 - Complete
The Sidhe by Chazzam reviews
Epic romantic fantasy adventure, seriously AU, with angst and fluff in equal measure. I can sense your hesitation, but just give the first chapter a try. It's been winning some folks over and it may surprise you.
Glee - Rated: M - English - Romance/Fantasy - Chapters: 33 - Words: 112,384 - Reviews: 3881 - Favs: 3,579 - Follows: 1,488 - Updated: 8/4/2015 - Published: 5/13/2011 - Blaine A., Kurt H. - Complete
Imperfection's Weakness by Schimelos reviews
Raven made a bad judgement call. Waking up with a hangover was the least of her worries. Now, she was must deal with the aftermath of a night of passion with a certain green Titan. BB/Raven. COMPLETE. Rated M for mature scenes and content.
Teen Titans - Rated: M - English - Romance/Humor - Chapters: 11 - Words: 17,345 - Reviews: 229 - Favs: 269 - Follows: 241 - Updated: 3/16/2015 - Published: 3/10/2007 - Raven, Beast Boy - Complete
Treat Tessellate by UnicornMachine reviews
After a near fatal plane crash on their way to the International Show Choir Competition, Glee's show choirs are all stranded on a tropical island together. Violence, smut, regression from society, Klaine, Brittana, etc.
Glee - Rated: M - English - Adventure/Romance - Chapters: 8 - Words: 29,301 - Reviews: 43 - Favs: 48 - Follows: 101 - Updated: 2/2/2015 - Published: 10/5/2011 - [Kurt H., Blaine A.] [Brittany P., Santana L.] - Complete
iCamp, Legends and Vampires by xxiCarlyFanxx reviews
When Freddie goes camping and he's attacked by something he didn't even know that existed, his life will never be the same. Will he be able to live like he was used to? How will his feelings for a certain blonde girl make it harder for him? SEDDIE! :D
iCarly - Rated: T - English - Romance/Supernatural - Chapters: 25 - Words: 81,952 - Reviews: 139 - Favs: 74 - Follows: 78 - Updated: 7/10/2014 - Published: 10/4/2009 - Freddie B., Sam P.
Tumbled by Keitorin Asthore reviews
A series of unrelated drabbles originally published on Tumblr, some just for fun and some as prompt fills. Drabble #291: "Insomnia"
Glee - Rated: T - English - Humor/Romance - Chapters: 291 - Words: 287,553 - Reviews: 8374 - Favs: 1,076 - Follows: 922 - Updated: 5/27/2014 - Published: 5/1/2011 - Kurt H., Finn H., Burt H., Blaine A.
Internet Killed The Video Star by Basser reviews
The Yarders discover some old photographs while investigating a crime scene. "Good lord, he was in a band."
Sherlock - Rated: K+ - English - Humor/Friendship - Chapters: 3 - Words: 9,900 - Reviews: 58 - Favs: 161 - Follows: 105 - Updated: 1/26/2014 - Published: 4/25/2012 - Sgt. S. Donavan, Sherlock H.
Home Again by michelle-lee92 reviews
When Sam's mum dies she is forced to go live with her aunt in Australia. she's 18 now and she's back in Seattle for a while. but it's not the Seattle she remembers. People have changed. Will Sam, Carly and Freddie ever be the same again? SEDDIE! ABANDONED!
iCarly - Rated: M - English - Romance/Drama - Chapters: 20 - Words: 40,148 - Reviews: 81 - Favs: 62 - Follows: 93 - Updated: 12/11/2013 - Published: 8/11/2009 - Freddie B., Sam P.
One Thing Leads to Another by katergator reviews
One thing leads to another when Starfire and Raven attend a lingerie party and Robin gets a surprise view of Starfire's new undergarment. StarxRob and RaexBB full summary inside
Teen Titans - Rated: M - English - Romance/Humor - Chapters: 42 - Words: 311,689 - Reviews: 1577 - Favs: 1,671 - Follows: 1,016 - Updated: 10/13/2013 - Published: 1/26/2007 - Robin, Starfire - Complete
Going Under by Schimelos reviews
When Raven has a bad vision, it leads her to leave the team and her boyfriend, Beast Boy. Now 6 months later, somethings after the team and the truth of Raven's disappearance comes to light. Everyone must rally to save the city and Raven from herself. R/BB UPDATED
Teen Titans - Rated: T - English - Drama/Romance - Chapters: 5 - Words: 8,248 - Reviews: 70 - Favs: 53 - Follows: 88 - Updated: 9/5/2013 - Published: 3/19/2007 - Beast Boy, Raven
iKnow it, and so does everybody by xxiCarlyFanxx reviews
Sam and Freddie like each other. Carly knows it, and tries to help them to get together, 'cuz she knows they won't admit their feelings for each other without a little help. But how? You will have to read to find out! SEDDIE! :D
iCarly - Rated: T - English - Romance/Humor - Chapters: 27 - Words: 59,540 - Reviews: 96 - Favs: 61 - Follows: 52 - Updated: 7/16/2013 - Published: 9/6/2009 - Freddie B., Sam P. - Complete
Of Boarding School and Super Powers by XxWithBrokenWingsXx reviews
Kurt is sent off to Dalton; a school for the unnatural and gifted. But will he be able to cope with still being different and special in a school full of 'freaks'
Glee - Rated: T - English - Supernatural/Romance - Chapters: 24 - Words: 83,844 - Reviews: 422 - Favs: 245 - Follows: 377 - Updated: 1/26/2013 - Published: 7/12/2011 - Kurt H., Blaine A.
Foster Home by obsessivegleekypotterhead reviews
The Hummel Family take care of Foster children. Kurt is very compassionate towards the kids like his mother was. One day, a new boy enters the family, a certain teenager named Blaine. Rated for smut.
Glee - Rated: M - English - Hurt/Comfort/Romance - Chapters: 23 - Words: 50,804 - Reviews: 209 - Favs: 149 - Follows: 274 - Updated: 1/11/2013 - Published: 7/28/2011 - Blaine A., Kurt H.
The Power of DVD by 101EmilyRox reviews
After BICO. It's Christmas and Blaine had a strange present under the tree from one Sue Sylvester. The entire box set of Glee season 1 & 2! What are the Warblers going to do with them? Watch them of course! Basically, a Warblers-watching-Kurt fic. KLAINE
Glee - Rated: T - English - Friendship/Romance - Chapters: 11 - Words: 30,928 - Reviews: 735 - Favs: 571 - Follows: 843 - Updated: 12/23/2012 - Published: 6/21/2011 - Blaine A., Kurt H.
Parents Really Shouldn't Date by person226 reviews
Sam's mom has a boyfriend with a son and Freddie's dad has a girlfriend with a daughter. The boyfriend of Sam's mom happens to have the same name as Freddie's dad and the girlfriend of Freddie's dad has the same name as Sam's mom. Coincidence? Seddie :
iCarly - Rated: T - English - Humor/Romance - Chapters: 24 - Words: 77,286 - Reviews: 642 - Favs: 220 - Follows: 240 - Updated: 11/19/2012 - Published: 11/5/2010 - Freddie B., Sam P.
Trip to Hawaii by Mike B Kittson reviews
The Titans are tired of having to stop a crime every second. Because of that, Robin decides to treat the team to a vacation in the island of Hawaii. Four of the Titans might discover more than just fun on their trip. BBxRae, RobxStar
Teen Titans - Rated: K+ - English - Romance - Chapters: 33 - Words: 32,920 - Reviews: 257 - Favs: 64 - Follows: 53 - Updated: 8/28/2012 - Published: 9/14/2006
Battle of the Changelings by DreamWriterx3 reviews
Beast-Boy's brother comes to Jump City and there becomes an attraction between him and Raven. He happens to be hot, 6'2, smart, cool, overly confident...and highly suspicious. My first ever FanFic! BBXRAE DISCLAIMER FOR IMAGE: It's from DC Comics itself! But yes...it's beautiful. And it's from Google.
Teen Titans - Rated: T - English - Romance/Drama - Chapters: 39 - Words: 62,525 - Reviews: 268 - Favs: 90 - Follows: 89 - Updated: 6/27/2012 - Published: 8/1/2009 - Beast Boy, Raven
Breeding Grounds by ur1onlybravecoward reviews
Dolphins and humans have something in common, and it's not that they're both mammals. What happens when a collector of rare items and people takes advantage of Beast Boy's animal instincts?
Teen Titans - Rated: T - English - Romance/Drama - Chapters: 24 - Words: 28,144 - Reviews: 249 - Favs: 158 - Follows: 227 - Updated: 6/7/2012 - Published: 3/24/2009 - Beast Boy, Raven
TeleKlainesis by MadiBuzz reviews
People always said that Kurt & Blaine acted like they could read each other's minds. What if it was true? What crazy situations could our favourite boys get themselves into? Fluffy, humorous Klaine story, read and review? Finished story. Rated T for minor swearing, sexual references and brief sensuality.
Glee - Rated: T - English - Romance/Humor - Chapters: 11 - Words: 15,690 - Reviews: 59 - Favs: 84 - Follows: 83 - Updated: 6/7/2012 - Published: 5/20/2011 - Blaine A., Kurt H. - Complete
Checkmate by iHeartE.D reviews
Takes place on the ocean liner: The conversation between Vlad and Dimitri as they are playing a simple game of chess, and Vlad can't help but notice his young ward's distracted behavior... Mild language, ONESHOT
Anastasia - Rated: K+ - English - Humor - Chapters: 2 - Words: 1,643 - Reviews: 12 - Favs: 63 - Follows: 5 - Updated: 5/12/2012 - Published: 12/30/2009 - Anya/Anastasia, Dimitri - Complete
Wendy by shotofwhiskey reviews
More Anderbros fluff. This is the story of two brothers and a cat. Pretty simple.
Glee - Rated: K+ - English - Friendship - Chapters: 1 - Words: 3,131 - Reviews: 3 - Favs: 6 - Published: 4/20/2012 - Blaine A., Cooper A. - Complete
Scars and Stones by Yoyodiza reviews
Blaine recounts what happened to him, about a time when he was an introverted soul and was beaten up for who he was. But, what happens when a blast from the past threatens to destroy everything good he's built for himself? Contains mention of hate crimes.
Glee - Rated: M - English - Hurt/Comfort/Angst - Chapters: 45 - Words: 67,009 - Reviews: 113 - Favs: 82 - Follows: 103 - Updated: 4/18/2012 - Published: 6/7/2011 - Blaine A., Kurt H.
Gas Pains My Ass by TexasTurtleFan reviews
What if the Warblers didn't give up on 'Animal' so quickly? Blaine is determined to help Kurt but maybe the soloist is biting off more than he can chew. Is he prepared for what he finds in search of other Sexy Show Choir Performance videos? Probably not.
Glee - Rated: T - English - Humor/Angst - Chapters: 12 - Words: 59,506 - Reviews: 419 - Favs: 629 - Follows: 521 - Updated: 3/30/2012 - Published: 8/23/2011 - Blaine A., Kurt H. - Complete
I Hate Judy by NikiGrace reviews
Kurt kidnaps and brutally murders Judy. Wes may never forgive him but the Warblers will hail him a hero. Not a Kurt/Wes pairing
Glee - Rated: K+ - English - Humor - Chapters: 5 - Words: 7,777 - Reviews: 27 - Favs: 43 - Follows: 55 - Updated: 3/26/2012 - Published: 6/24/2011 - Kurt H., Wes
Taken by elitejace452 reviews
Someone takes Prentiss and Reid... Will the team be able to find them before the unsub breaks them? Warning: Torture
Criminal Minds - Rated: T - English - Angst/Hurt/Comfort - Chapters: 6 - Words: 11,885 - Reviews: 86 - Favs: 145 - Follows: 123 - Updated: 3/17/2012 - Published: 12/27/2010 - E. Prentiss, S. Reid - Complete
Enchanted by bowtiesandglitter reviews
Blaine's feelings and thoughts after Kurt dies. Warning: you might cry
Glee - Rated: K+ - English - Tragedy - Chapters: 4 - Words: 973 - Reviews: 12 - Favs: 14 - Follows: 10 - Updated: 3/14/2012 - Published: 6/23/2011 - Blaine A., Kurt H. - Complete
What Brings Us Closer Together by CrazedLunatic reviews
When Kurt is attacked, Blaine instantly leaves college to take care of him. With one decision, their entire relationship is changed and their futures reshaped. It also makes everyone around them realize just how close they really are. AU.
Glee - Rated: T - English - Romance/Angst - Chapters: 39 - Words: 409,852 - Reviews: 1932 - Favs: 1,473 - Follows: 1,119 - Updated: 3/12/2012 - Published: 3/31/2011 - Blaine A., Kurt H. - Complete
A Summer of Clichés by A-Simple-Rainbow reviews
The Hudmels decided to go to one of Europe's sunniest countries on vacation... Kurt was sure it wouldn't be worth it. He was so getting skin cancer. And it would be their fault. Nothing, nothing, would be worth two weeks of cancerous Sun. Or...? AU
Glee - Rated: M - English - Romance/Humor - Chapters: 21 - Words: 110,703 - Reviews: 203 - Favs: 304 - Follows: 218 - Updated: 3/10/2012 - Published: 8/13/2011 - Kurt H., Blaine A. - Complete
A Beautiful Mistake by scarlettfire reviews
Kurt must learn to adapt to a whole new set of rules when the unexpected occurs. AU
Glee - Rated: T - English - Romance/Family - Chapters: 42 - Words: 111,866 - Reviews: 717 - Favs: 735 - Follows: 571 - Updated: 1/27/2012 - Published: 7/12/2011 - Kurt H., Blaine A. - Complete
Once In A Lullaby by arainymonday reviews
On his way to Dalton to spy on the Warblers Kurt is transported to another world where all lost things end up. There he meets Blaine and gets a chance to find himself again. An AU Season 2 modern fantasy.
Glee - Rated: T - English - Fantasy/Romance - Chapters: 68 - Words: 163,681 - Reviews: 809 - Favs: 575 - Follows: 337 - Updated: 1/18/2012 - Published: 11/14/2011 - Kurt H., Blaine A. - Complete
One Hand, One Heart by pineappletop92 reviews
Ever since high school, Kurt and Blaine have always had this thing where they draw a heart on each other's hand. No one else really understands it - but then again, they don't really need to. ONESHOT.
Glee - Rated: K+ - English - Romance - Chapters: 1 - Words: 3,186 - Reviews: 68 - Favs: 200 - Follows: 19 - Published: 1/16/2012 - Kurt H., Blaine A. - Complete
Missed Opportunities by hudmelsonberry reviews
Aww... that's so cute! Are they gonna... oh, they better... it's the perfect opportunity.. oh, well maybe next time. Here's a tribute to all the missed Klisses. R&R!
Glee - Rated: T - English - Romance - Chapters: 62 - Words: 123,360 - Reviews: 919 - Favs: 256 - Follows: 229 - Updated: 1/2/2012 - Published: 6/29/2011 - Blaine A., Kurt H.
No Such Thing by Greg'sgirl5 reviews
Coincedences aren't real. The team is in danger while searching a narcissistic unsubs house. Will they make it out alive, or will a crazed serial killer have his way? Set in season 5. FINALLY, we have approached the epilogue!
Criminal Minds - Rated: T - English - Drama/Suspense - Chapters: 22 - Words: 47,169 - Reviews: 168 - Favs: 119 - Follows: 111 - Updated: 12/27/2011 - Published: 3/11/2011 - E. Prentiss, S. Reid
Cirque de Joie by Sharmain reviews
Blaine has been part of the Cirque de Joie for most of his life, being the 'handy man' around the circus. He yearns to be a performer but he has none of the talent. Just when he thought there was nothing left for him, a new aerialist joins the Cirque. AU
Glee - Rated: T - English - Drama/Romance - Chapters: 30 - Words: 80,548 - Reviews: 449 - Favs: 565 - Follows: 478 - Updated: 12/24/2011 - Published: 2/24/2011 - Blaine A., Kurt H. - Complete
Strange Attractors by NotAContrivance reviews
And, so, like always, Derek took what he wanted by force.
Life With Derek - Rated: T - English - Romance/Family - Chapters: 25 - Words: 429,413 - Reviews: 239 - Favs: 121 - Follows: 97 - Updated: 12/24/2011 - Published: 10/26/2008 - Edwin V., Lizzie M.
It Gets Better by for always forever reviews
"The fame and crap? I don't care. This man? He's all I need. I'm not talking about the platinum records or whatever when I tell you that it gets better." Kurt and Blaine make an It Gets Better video and fail terribly. Now with bonus Brittana chapter!
Glee - Rated: T - English - Humor/Romance - Chapters: 2 - Words: 2,906 - Reviews: 61 - Favs: 206 - Follows: 30 - Updated: 12/11/2011 - Published: 5/12/2011 - Kurt H., Blaine A. - Complete
You'd Better Run by perchance to wake reviews
... if you want to survive. Blaine post-Sadie Hawkins Dance. Everything hurt, and he didn't know how to stop it. One-shot. Rated T for bad language.
Glee - Rated: T - English - Angst - Chapters: 1 - Words: 1,334 - Reviews: 7 - Favs: 7 - Published: 12/8/2011 - Blaine A. - Complete
He was Furniture by SimplyCecelia reviews
When Blaine's father was sober Blaine kept his head down, and his mouth shut. But when his father opened the liquor cabinet, Blaine knew to run.
Glee - Rated: M - English - Angst - Chapters: 4 - Words: 12,185 - Reviews: 11 - Favs: 22 - Follows: 36 - Updated: 12/5/2011 - Published: 8/1/2011 - Blaine A., Kurt H.
Blaine Has A Secret by crazytheatrekid14 reviews
Blaine is hiding something from Kurt. How does Kurt react when he finds out what Blaine is so intent on hiding? Klaine obviously. first fic to be published...let's be nice to the author k?
Glee - Rated: M - English - Chapters: 12 - Words: 18,355 - Reviews: 23 - Favs: 36 - Follows: 61 - Updated: 12/1/2011 - Published: 4/11/2011 - Blaine A., Kurt H.
Side Of The Road by embrace-the-deception reviews
"Stop that, or I'll stop the car and make you walk home." We've all heard it. But for Blaine, it means something and that something hurts. Angst, past Blaine, future family Klaine, touch of fluff. ONESHOT
Glee - Rated: T - English - Angst/Family - Chapters: 1 - Words: 3,991 - Reviews: 27 - Favs: 84 - Follows: 9 - Published: 12/1/2011 - Kurt H., Blaine A. - Complete
Send Me An Angel by ASimplyHopelessRomantic reviews
After a gay-bashing that changes his life forever, Kurt vows to never sing again. That is, until he meets Blaine Anderson, who will not only help Kurt regain his faith, but find who he is truly meant to be.
Glee - Rated: T - English - Hurt/Comfort/Romance - Chapters: 29 - Words: 31,949 - Reviews: 174 - Favs: 123 - Follows: 258 - Updated: 11/19/2011 - Published: 6/28/2011 - Kurt H., Blaine A.
Secrets Hidden, Secrets Found by warblingaway reviews
Everyone has secrets. Some are big, some are small. But Kurt and Blaine have lots of them, and Wes and David are determined to get them out into the open. Klaine with Wes and David and occasional ND's. Chapter 50: Dating a Diva
Glee - Rated: T - English - Humor/Romance - Chapters: 50 - Words: 142,146 - Reviews: 555 - Favs: 287 - Follows: 250 - Updated: 11/13/2011 - Published: 6/26/2011 - Blaine A., Kurt H.
Sadie Hawkin's Dance by dalecoops54 reviews
Oneshot. Blesse. A new take on what happened at the Sadie Hawkin's Dance, who got beat up, the aftermath, etc. Rated M for language and a brief sexual scene in a bathroom. Fun, fun. Trigger warning: self-harm. Nothing descriptive. Just a mention of it.
Glee - Rated: M - English - Romance/Angst - Chapters: 1 - Words: 4,998 - Reviews: 2 - Favs: 10 - Follows: 2 - Published: 11/4/2011 - Blaine A., Jesse sJ. - Complete
Confused by xSlythStratasfaction reviews
Kurt feels left behind when Blaine starts dating Rachel and ignoring him. Things have changed between the two boys. Will things ever go back to normal? Set during BIOTA and the beginning of SEXY. COMPLETE - ALTERNATE ENDING NOW UP!
Glee - Rated: T - English - Angst/Hurt/Comfort - Chapters: 21 - Words: 72,805 - Reviews: 266 - Favs: 349 - Follows: 343 - Updated: 11/2/2011 - Published: 5/4/2011 - Kurt H., Blaine A. - Complete
No Place Like Home by ImaginedInsanity reviews
Kurt helps Blaine tell his parents about their relationship, and helps him find a new home when they kick him out. Rachel has two gay dads who know what the boys are going through, and Rachel always wanted a brother! VIOLENCE IN CHAPTER 32- NOW COMPLETE!
Glee - Rated: M - English - Romance - Chapters: 50 - Words: 111,565 - Reviews: 1032 - Favs: 756 - Follows: 623 - Updated: 11/1/2011 - Published: 3/19/2011 - Blaine A., Kurt H. - Complete
I Will Remember You by Chloe Winchester reviews
"Please, you can't do this. Don't take my son away." "Don't make me go, Daddy. Mommy lived here." "I know, Kurt, but Daddy doesn't have a choice." Baby!Klaine Warnings will vary.
Glee - Rated: M - English - Hurt/Comfort/Angst - Chapters: 7 - Words: 11,838 - Reviews: 121 - Favs: 206 - Follows: 126 - Updated: 10/29/2011 - Published: 9/1/2011 - Kurt H., Blaine A. - Complete
Nobody's Home by nukagirl reviews
Blaine just wanted to go home, play his guitar and then go to bed. However, his father had completely different ideas, as he shoved the picture of Kurt and him kissing in Blaine's face. He finds himself homeless, broken and alone.
Glee - Rated: T - English - Angst/Hurt/Comfort - Chapters: 9 - Words: 85,173 - Reviews: 172 - Favs: 337 - Follows: 256 - Updated: 10/27/2011 - Published: 6/18/2011 - Blaine A., Kurt H. - Complete
Jealous of the Moon by musiclover48 reviews
Kurt and Blaine, both longing for their life partner, have yet to meet, and are only guided by the names written on each others palms. Somehow, someway, they'll meet one day, and will finally find what they've been looking for: a soulmate.
Glee - Rated: T - English - Romance/Drama - Chapters: 12 - Words: 19,365 - Reviews: 398 - Favs: 577 - Follows: 396 - Updated: 10/21/2011 - Published: 7/13/2011 - Kurt H., Blaine A. - Complete
Kurt Hummel's Bulging Pink Fun Sack by ImaginedInsanity reviews
I couldn't resist! Blaine comes over after Brittany leaves, to find Kurt's room covered in pink and unicorns... And one very interesting little bag... Set during I Am Unicorn. Oneshot.
Glee - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 1,395 - Reviews: 22 - Favs: 83 - Follows: 5 - Published: 10/10/2011 - Blaine A., Kurt H. - Complete
Mirror Images by KasadyaAlyce reviews
What happens when two people fall in love and their jobs are caught in the crossfire? Annabel Kenner is like nothing Spencer Reid has ever seen. With an IQ higher than his own, he can't help but be in awe of her.
Criminal Minds - Rated: K+ - English - Crime/Romance - Chapters: 8 - Words: 15,696 - Reviews: 10 - Favs: 23 - Follows: 23 - Updated: 10/7/2011 - Published: 7/7/2011 - S. Reid
Sing by bananathebookworm reviews
When Blaine transfers, Mr. Schue won't let him join Glee out of fear of another Jesse incident. Then he realizes how much the boy needs the Glee Club; needs the music. Based off an angst meme prompt.
Glee - Rated: T - English - Hurt/Comfort/Angst - Chapters: 1 - Words: 2,075 - Reviews: 12 - Favs: 68 - Follows: 9 - Published: 10/6/2011 - Blaine A., Will S. - Complete
Our Baby Girl by Lifesjustducky reviews
Being a parent is never easy. Our favorite couple, Kurt and Blaine are no exception. But, through love, they're able to raise Samantha Hummel-Anderson right. Of course, there's lots of humor, drama, awkward-ness, sadness, and craziness on the way! KLAINE!
Glee - Rated: T - English - Family/Humor - Chapters: 40 - Words: 34,612 - Reviews: 212 - Favs: 111 - Follows: 117 - Updated: 9/30/2011 - Published: 1/19/2011 - Kurt H., Blaine A. - Complete
Katara's Revenge by Vessa Blackheart reviews
Katara kills her mother's killer, and the gAang rejects her. Everyone except the newly acquired member, Zuko. In fact, he is the only one who offers comfort, advice and...his body? Can love blossom in the face of guilt, grief and Sozin's comet? Review!
Avatar: Last Airbender - Rated: M - English - Romance/Drama - Chapters: 13 - Words: 37,968 - Reviews: 261 - Favs: 595 - Follows: 182 - Updated: 9/27/2011 - Published: 3/26/2010 - Zuko, Katara - Complete
Ashes, Ashes by OwlheadAthena reviews
... I can't. Fall. Down. Horror story, no pairings. Slight OOCness, but I just started getting back into Teen Titans, so cut me some slack.
Teen Titans - Rated: T - English - Horror/Angst - Chapters: 1 - Words: 1,585 - Reviews: 3 - Favs: 10 - Follows: 2 - Published: 9/27/2011 - Beast Boy, Starfire - Complete
Lima's Secret by E.E.Cummingz reviews
Kurt and Blaine go to a gay bar, called Lima's Secret, the night takes a wild turn that neither of them were expecting.
Glee - Rated: M - English - Romance - Chapters: 2 - Words: 4,240 - Reviews: 19 - Favs: 60 - Follows: 47 - Updated: 9/26/2011 - Published: 9/23/2011 - Kurt H., Blaine A. - Complete
All We'd Ever Need by MissSnowFox reviews
A one shot born from the possible new Blaine spoilers.
Glee - Rated: K+ - English - Romance/Angst - Chapters: 1 - Words: 5,184 - Reviews: 11 - Favs: 28 - Follows: 3 - Published: 9/25/2011 - Kurt H., Blaine A. - Complete
Aftermath by needsmoreslashfiction reviews
It was one simple mistake on Kurt's part that led to the fire that tore his life apart. With Blaine by his side, will he be able to recover? Klaine; set post-New York.
Glee - Rated: T - English - Tragedy/Romance - Chapters: 5 - Words: 14,207 - Reviews: 9 - Favs: 16 - Follows: 14 - Updated: 9/25/2011 - Published: 9/17/2011 - Kurt H., Blaine A. - Complete
Why do you see right through me? by ohblainers reviews
Blaine arrives at school one day, and realizes that no matter how loud he talks or how much he tries to get their attention, no one seems to be able to hear him or see him. Rated T for some swearing. Klaine with Blaine/Tina friendship.
Glee - Rated: T - English - Supernatural/Romance - Chapters: 3 - Words: 3,952 - Reviews: 10 - Favs: 12 - Follows: 16 - Updated: 9/25/2011 - Published: 9/24/2011 - Kurt H., Blaine A.
Even If You Never Love Me by DustyDreams reviews
"In a perfect world, I'd be able to know what it's like to... hold your hand? Take you on a date? Kiss you? You'd let me feel what it's like to be your boyfriend, just for a day. Just for one day. One day where you're mine?"
Glee - Rated: T - English - Angst/Romance - Chapters: 15 - Words: 45,598 - Reviews: 257 - Favs: 145 - Follows: 297 - Updated: 9/24/2011 - Published: 6/26/2011 - Blaine A., Kurt H.
Lima's Gay Rite of Passage by thedarklordfluffy reviews
Finn tells Kurt and Blaine about his tendency to meet really nice guys that are willing to give him free or discounted stuff...
Glee - Rated: K - English - Humor - Chapters: 1 - Words: 1,092 - Reviews: 3 - Favs: 10 - Published: 9/24/2011 - Finn H. - Complete
Into the Dark by sparxxa
Looking back he knows that they should have trusted Matt, right from the start.
Glee - Rated: T - English - Angst - Chapters: 1 - Words: 1,454 - Favs: 3 - Follows: 1 - Published: 9/24/2011 - Blaine A. - Complete
It Gets Better by InEternalDarkness reviews
Kurt Hummel is back at McKinley, and all is happiness and rainbows! ... Or not. Rated T for language kind of mature, possibly triggering themes in pretty much all of the beginning chapters. Also, very much Klaine.
Glee - Rated: T - English - Drama/Romance - Chapters: 6 - Words: 10,415 - Reviews: 3 - Favs: 4 - Follows: 8 - Updated: 9/22/2011 - Published: 8/21/2011 - Kurt H., Blaine A.
See me Please, please see me Save me by Marte reviews
There was another, deeper, reason Blaine decided to transfer. This is from his point of view during the season premiere. You heard the words, but did you understand the looks and the gestures? Read my interpretation.
Glee - Rated: T - English - Angst/Romance - Chapters: 1 - Words: 2,715 - Reviews: 15 - Favs: 19 - Follows: 1 - Published: 9/21/2011 - Blaine A., Kurt H. - Complete
no celestial body could compare to you by staccato ramble reviews
Scenes from the summer where Blaine Anderson revealed he wasn't exactly human. This, coincidentally, happens to be the best summer of his life . Alien AU.
Glee - Rated: T - English - Romance/Sci-Fi - Chapters: 16 - Words: 8,490 - Reviews: 37 - Favs: 27 - Follows: 39 - Updated: 9/20/2011 - Published: 7/8/2011 - Blaine A., Kurt H. - Complete
Catch the Wind by arainymonday reviews
They had talked about their families enough for Kurt to know three things. One, the Andersons do not get along. Two, the Andersons are not happy. Three, Blaine does not feel loved by them. But he had no idea it was this bad. Sequel to One Fine Day.
Glee - Rated: T - English - Family/Angst - Chapters: 11 - Words: 24,029 - Reviews: 93 - Favs: 137 - Follows: 92 - Updated: 9/19/2011 - Published: 9/9/2011 - Blaine A., Kurt H. - Complete
The Accident by LittleMissMollah reviews
Kurt remembers the fateful car accident. Warnings for intense angst and creys. TRIGGER WARNING: Rated M for character death and mentions of suicide.
Glee - Rated: M - English - Angst/Romance - Chapters: 2 - Words: 2,417 - Reviews: 11 - Favs: 23 - Follows: 7 - Updated: 9/18/2011 - Published: 6/1/2011 - Kurt H., Blaine A. - Complete
Touch Me by Chaotic Inverse reviews
Because Blaine is cursed and Kurt's just the boy who loves him. magical oneshot
Glee - Rated: T - English - Romance/Fantasy - Chapters: 1 - Words: 7,945 - Reviews: 7 - Favs: 28 - Follows: 2 - Published: 9/17/2011 - Blaine A., Kurt H. - Complete
Let Go by acommontater
We can give you a new body; you will miss your parents, and the sun, but you could sing.
Glee - Rated: K+ - English - Angst/Supernatural - Chapters: 1 - Words: 453 - Favs: 1 - Published: 9/13/2011 - Blaine A.
Dismiss Your Fears by Unwritten.25 reviews
Klaine. When Burt dies instead of waking up from his coma, Kurt goes mute. The summer after his junior year, Kurt works in his aunt's secondhand bookshop, the same place where Blaine applies for a job as live entertainment. H/C, character death.
Glee - Rated: T - English - Angst/Hurt/Comfort - Chapters: 3 - Words: 49,483 - Reviews: 73 - Favs: 408 - Follows: 79 - Published: 9/12/2011 - Kurt H., Blaine A. - Complete
Better Run, Outrun My Gun by your.kat reviews
The zombie apocalypse happens. This is the story of how the members of New Directions survive – or don't survive, as the case may be. FABERRY, Brittana, Samcedes, Klaine, Tike, Wilma, and every other romance or bromance ever imagined.
Glee - Rated: M - English - Adventure/Romance - Chapters: 1 - Words: 34,156 - Reviews: 295 - Favs: 1,394 - Follows: 158 - Published: 9/12/2011 - Quinn F., Rachel B. - Complete
The Final Straw by jay64 reviews
When Kurt meets Blaine everything seems normal at first but soon Kurt begins to suspect Blaine is hiding something from him.
Glee - Rated: T - English - Romance/Family - Chapters: 7 - Words: 12,907 - Reviews: 10 - Favs: 7 - Follows: 19 - Updated: 9/8/2011 - Published: 7/28/2011 - Blaine A., Kurt H. - Complete
Goodbye by xSlythStratasfaction reviews
In that dark, desolate stairwell, the place that started it all and would now be the end of everything, Kurt Hummel has to say goodbye to the one thing he promised he'd never let go of.
Glee - Rated: M - English - Horror/Angst - Chapters: 1 - Words: 2,803 - Reviews: 10 - Favs: 31 - Follows: 4 - Published: 9/7/2011 - Kurt H., Blaine A. - Complete
Singin' in the Gore by Pippin's Socks reviews
AU. Because the middle of a zombie apocalypse is the perfect place to start having your teenaged romance. Klaine. For Nezz.
Glee - Rated: T - English - Humor/Romance - Chapters: 1 - Words: 1,003 - Reviews: 13 - Favs: 31 - Follows: 2 - Published: 9/6/2011 - Blaine A., Kurt H. - Complete
I'd brush the Summer by by wild wolf free17 reviews
"Parents make us who we are," Mr. Schuster elaborates, writing PARENTS on the board, underlining and circling it. Kurt/Blaine, senior year, angst and fluff abounds
Glee - Rated: T - English - Chapters: 5 - Words: 27,729 - Reviews: 44 - Favs: 103 - Follows: 93 - Updated: 9/6/2011 - Published: 8/26/2011 - Blaine A., Kurt H. - Complete
5 Times the Gleeks Thought Kurt Was Pregnant by Azara-Rayne18 reviews
And 1 time they found out Blaine was. When the glee club finds out that our boys are pregnant, they assume it's Kurt. They're wrong. Fill for the GleeAngstMeme. Involves pregnant Klaine at McKinley. A mix between fluff, crack, and angst.
Glee - Rated: T - English - Angst/Humor - Chapters: 6 - Words: 4,612 - Reviews: 119 - Favs: 318 - Follows: 157 - Updated: 9/4/2011 - Published: 6/30/2011 - Blaine A., Kurt H. - Complete
Kidnapped by CorinneLeorrah reviews
Kurt gets kidnapped by some crazy guys and he's not the only one. Hopefully he and his new friends can escape before anyone gets hurt. Meanwhile Burt tries to deal with his son's disappearance. Lots of OCs and some gay romance 3
Glee - Rated: T - English - Hurt/Comfort/Friendship - Chapters: 15 - Words: 15,075 - Reviews: 61 - Favs: 54 - Follows: 42 - Updated: 9/4/2011 - Published: 8/21/2011 - Kurt H., Burt H. - Complete
A New Beginning by Wakah reviews
Kurt is lonely, tormented and alone. One day he finds out the prince of a country far, far away has died, making him the new prince. Kurt's life changes in one day. He meets people who accept him and he even falls for his mentor, Blaine.
Glee - Rated: T - English - Fantasy/Romance - Chapters: 7 - Words: 28,259 - Reviews: 39 - Favs: 38 - Follows: 67 - Updated: 9/4/2011 - Published: 8/8/2011 - Kurt H., Blaine A.
Welcome to McKinley by KlaineFreakk reviews
When Blaine transferes to McKinley for his senior year, he brings a certain friend with him, Will glee be able to survive her whirlwind? KLAINE FANFIC! Features characters from the glee project, Deal with me, im bad a summeries. M for self harm!
Glee - Rated: M - English - Romance/Humor - Chapters: 15 - Words: 18,182 - Reviews: 21 - Favs: 25 - Follows: 15 - Updated: 9/4/2011 - Published: 8/16/2011 - Blaine A., Kurt H. - Complete
Exploring the past by inkinmyheartandonthepage reviews
A gypsy at the fair takes the Warblers on wild ride to Kurt's past. KLAINE! Jeff/Nick! Disclaimer: I don't own glee! Please r&r! rated T. featuring baby kurt! Todler Kurt! and much more! little bit of angst for bullying.
Glee - Rated: T - English - Romance/Hurt/Comfort - Chapters: 8 - Words: 10,240 - Reviews: 81 - Favs: 338 - Follows: 101 - Updated: 9/3/2011 - Published: 8/31/2011 - Blaine A., Kurt H. - Complete
The Cowardly Lion by flirtingintechnicolor reviews
After running away into the night with his sobbing mother from an abusive father, six year old Blaine is introduced to the idea of courage. Includes spousal violence and child abuse.
Glee - Rated: T - English - Hurt/Comfort/Family - Chapters: 1 - Words: 2,946 - Reviews: 5 - Favs: 14 - Follows: 12 - Published: 9/2/2011 - Blaine A., Kurt H.
But I Turn Him On and He Comes to Life by likeasouffle reviews
Written for the following prompt: Inspired by Darren Criss' remark about Blaine being a mad scientist who built a school of robots. When Blaine meets Kurt, he realizes that he is missing something. He doesn't want a robot, he wants the real thing.
Glee - Rated: M - English - Sci-Fi/Romance - Chapters: 1 - Words: 4,689 - Reviews: 10 - Favs: 43 - Follows: 2 - Published: 9/2/2011 - Blaine A., Kurt H. - Complete
The Pamphlet Method by poisonivy231 reviews
Blaine accidentally finds Kurt's pamphlets in his bedside table, but his reaction is not the one Kurt expected.
Glee - Rated: M - English - Romance - Chapters: 1 - Words: 3,145 - Reviews: 15 - Favs: 122 - Follows: 18 - Published: 9/2/2011 - Kurt H., Blaine A. - Complete
Pull Me Closer by poisonivy231 reviews
"Blaine, are you inviting me back to your empty, parentless house? On prom night?" A post-prom love/smut fic.
Glee - Rated: M - English - Romance - Chapters: 1 - Words: 5,658 - Reviews: 16 - Favs: 89 - Follows: 10 - Published: 9/1/2011 - Kurt H., Blaine A. - Complete
An Instant of Agony by Crosis Laurekal reviews
In a single second, she caused him more pain than he had ever felt in his life. But what hurt the most wasn't that she had almost killed him: it was that she had done it with a smile on her face, with all their friends watching.
Teen Titans - Rated: T - English - Angst/Horror - Chapters: 1 - Words: 1,552 - Reviews: 21 - Favs: 63 - Follows: 7 - Published: 8/28/2011 - Beast Boy, Raven - Complete
The Past Really Explains Things by Jinxometer reviews
Lily Raven and Beast Boy's 15 year old daughter has to go back in time and warn the Titans what is to come. The catch is that she can't tell them who her father is.BBxRAE ROBxSTAR CYxBEE. COMPLETE
Teen Titans - Rated: T - English - Family/Humor - Chapters: 14 - Words: 48,688 - Reviews: 115 - Favs: 142 - Follows: 74 - Updated: 8/28/2011 - Published: 11/2/2009 - Raven, Beast Boy - Complete
My Last Breath by IantoCriss reviews
5 times Kurt Hummel joked about suicide, and the 1 time it wasn't a joke.
Glee - Rated: K+ - English - Angst/Romance - Chapters: 1 - Words: 2,732 - Reviews: 30 - Favs: 157 - Follows: 26 - Published: 8/26/2011 - Kurt H., Blaine A. - Complete
Four rings, two boys, one marriage by TheWitchOfTheSouth reviews
In all engagement fics I've read, Blaine is the one who proposes. But I think take charge, goes for what he wants, romantic, would want to pick his own ring out Kurt would be the one to do it. Nevertheless, Blaine has something in mind too! Proposal fic.
Glee - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 2,060 - Reviews: 6 - Favs: 17 - Follows: 2 - Published: 8/26/2011 - Kurt H., Blaine A. - Complete
One Fine Day by arainymonday reviews
They had talked about their dads enough for Kurt to know three things. One, Mr. Anderson desperately wanted a straight son. Two, Blaine desperately wanted an accepting father. Three, Kurt had everything Blaine wanted.
Glee - Rated: T - English - Family/Angst - Chapters: 14 - Words: 34,325 - Reviews: 130 - Favs: 359 - Follows: 134 - Updated: 8/25/2011 - Published: 8/12/2011 - Blaine A., Kurt H. - Complete
Fathers by OnceinYourLife reviews
"I love my son, and my son loves Blaine. He matters to me." While the glee club is in New York, Burt receives an unexpected visitor.
Glee - Rated: T - English - Family/Hurt/Comfort - Chapters: 31 - Words: 140,993 - Reviews: 1807 - Favs: 1,403 - Follows: 571 - Updated: 8/22/2011 - Published: 5/20/2011 - Burt H., Blaine A. - Complete
iSpeak Sleeping by xxiCarlyFanxx reviews
When Freddie forgets his cellphone at Carly's apartment and goes there to take it at one in the morning, what will happen when he finds a certain blond girl sleeping on the couch? What will she say while she's sleeping? SEDDIE! not an oneshot anymore!
iCarly - Rated: T - English - Romance - Chapters: 7 - Words: 9,134 - Reviews: 65 - Favs: 58 - Follows: 36 - Updated: 8/20/2011 - Published: 8/24/2009 - Freddie B., Sam P. - Complete
Scattered Pieces by Chidney reviews
A short Oneshot. Kurt is having a hard time facing memories.
Glee - Rated: K+ - English - Romance/Hurt/Comfort - Chapters: 1 - Words: 560 - Reviews: 2 - Favs: 6 - Published: 8/18/2011 - Kurt H., Blaine A. - Complete
Sixth Sense by DivawearspradaXglee reviews
THIS IS ONE OF THE SECRET STORIES! Kurt's acting weird and Blaine and the glee club start to notice. Something is seriously wrong with Kurt, but what? Can they save him in time? rated M because I'm paranoid of the future content.
Glee - Rated: M - English - Mystery/Supernatural - Chapters: 3 - Words: 3,451 - Reviews: 10 - Favs: 15 - Follows: 34 - Updated: 8/18/2011 - Published: 6/29/2011 - Kurt H., Blaine A.
Steps that Lead To Love by MusicBoxMelody reviews
Tells the story of Blaine and Kurt through Blaine's eyes. What was going through his head when they first met? When he found out about Karofsky's kiss? Dialogue and scenes mostly from the show, with new scenes added in. Starts at episode 2x6.
Glee - Rated: T - English - Romance/Hurt/Comfort - Chapters: 2 - Words: 4,919 - Reviews: 7 - Favs: 19 - Follows: 26 - Updated: 8/17/2011 - Published: 7/31/2011 - Blaine A., Kurt H.
A Different Beginning by Quirky-Fan reviews
Nobody pushes Kurt Hummel around. With a bad-boy, sexy, in a punk band boyfriend, Blaine. An icy stare and hot strut, nobody has really tried in a while. So why is he sitting in a room full of misfits who call themselves New Directions? Klaine AU
Glee - Rated: M - English - Romance/Drama - Chapters: 2 - Words: 6,415 - Reviews: 31 - Favs: 60 - Follows: 99 - Updated: 8/17/2011 - Published: 8/16/2011 - Kurt H., Blaine A.
it was wrong to do that said the angel by ellemedit reviews
Prompt: The English teacher at Dalton is kinda creepy. All the guys agree that there's just something not right about Mr. Hopper.
Glee - Rated: M - English - Angst/Horror - Chapters: 1 - Words: 2,871 - Reviews: 33 - Favs: 93 - Follows: 14 - Published: 8/15/2011 - Blaine A., Kurt H. - Complete
Blurt by kaitouahiru reviews
There's a reason Kurt and Blaine want to be known as "Klaine" and not "Blurt."
Glee - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 2,690 - Reviews: 16 - Favs: 84 - Follows: 9 - Published: 8/14/2011 - Kurt H., Blaine A. - Complete
Time To Think by estibob reviews
Blaine finds himself with too much time on his hands whilst visiting Kurt in hospital. He can't help but feel guilty about the event that put the love of his life into a unresponsive state!
Glee - Rated: K - English - Tragedy/Friendship - Chapters: 1 - Words: 985 - Reviews: 2 - Favs: 4 - Follows: 5 - Published: 8/14/2011 - Blaine A., Kurt H.
look into my eyes, meet me there, don't look down by blackmustache reviews
Kurt and Blaine take a trip to check out New York before college, and Blaine isn't being himself.
Glee - Rated: K - English - Romance - Chapters: 1 - Words: 2,899 - Reviews: 2 - Favs: 20 - Follows: 1 - Published: 8/14/2011 - Kurt H., Blaine A. - Complete
And We'll Never Miss a Party by fleurdelisee reviews
New Directions is having a party and with too much alcohol comes terrible game ideas, or the one where Santana dares Kurt to go down on Blaine.
Glee - Rated: M - English - Humor/Romance - Chapters: 2 - Words: 8,637 - Reviews: 33 - Favs: 226 - Follows: 32 - Updated: 8/10/2011 - Published: 5/16/2011 - Kurt H., Blaine A. - Complete
The Crayola Confrontation by MyHistrionics reviews
Darren and Chris take a break after a day of shooting accompanied by a box of crayons and a Disney coloring book. Chris eventually comes to learn about one of Darren's quirks. Chris/Darren friendship. Oneshot. Drabble.
Glee - Rated: T - English - Friendship/Humor - Chapters: 1 - Words: 1,105 - Reviews: 14 - Favs: 47 - Follows: 5 - Published: 8/10/2011 - Blaine A., Kurt H. - Complete
The Salt On My Lips Is An Enzyme by rayychel infinity reviews
"CanIrimyou?" Kurt gets out in a rush of breath, digging his nails into his thigh as he exhales and holds his breath. So maybe that wasn't how it was supposed to go, but it'd have to do.
Glee - Rated: M - English - Romance - Chapters: 1 - Words: 3,371 - Reviews: 11 - Favs: 95 - Follows: 11 - Published: 8/10/2011 - Blaine A., Kurt H. - Complete
Get Up On This by BlaineyDevon reviews
Kurt and Blaine get caught making out all over Dalton. It gets so bad that it's time for a little parent teacher conference. One shot
Glee - Rated: M - English - Romance/Humor - Chapters: 1 - Words: 2,372 - Reviews: 67 - Favs: 264 - Follows: 46 - Published: 8/9/2011 - Kurt H., Blaine A. - Complete
Texts From Last Night by klemonademouth reviews
And here Blaine is, staring down at a text message from Kurt saying that sometimes he pictures Blaine naked. He's never entertained the notion that Kurt might possibly be imagining the same things. His throat is parched. Klaine. NC-17.
Glee - Rated: M - English - Romance - Chapters: 1 - Words: 2,328 - Reviews: 40 - Favs: 210 - Follows: 22 - Published: 8/7/2011 - Blaine A., Kurt H. - Complete
Ten Commandments by Force-A-Pancakes reviews
"You filthy sodomites must learn and if I must use violence to consolidate God's will then so be it." Cortes drawled, voice utterly devoid of emotion as Miguel trembled in his hold. "Don't touch him, you monster." Tulio spat. "/I/ won't. But you will."
Road to Eldorado - Rated: T - English - Hurt/Comfort/Romance - Chapters: 2 - Words: 7,185 - Reviews: 21 - Favs: 42 - Follows: 41 - Updated: 8/5/2011 - Published: 7/16/2011
into the light of the dark, black night by particularly good finder reviews
Surrounded by shadows, Blaine hides.
Glee - Rated: T - English - Drama/Angst - Chapters: 1 - Words: 518 - Reviews: 11 - Favs: 14 - Follows: 2 - Published: 8/4/2011 - Blaine A., Kurt H. - Complete
Crushed by embrace-the-deception reviews
Finn, Kurt and Blaine are involved in a horrific car accident. One of them is severely injured in the crash, and everyone's afraid he might not make it. Klaine with a bit of Finchel and Finn/Quinn. COMPLETE
Glee - Rated: T - English - Hurt/Comfort/Friendship - Chapters: 14 - Words: 23,369 - Reviews: 55 - Favs: 105 - Follows: 92 - Updated: 8/3/2011 - Published: 4/28/2011 - Kurt H., Finn H. - Complete
Mixed Signals by SolarMorrigan reviews
Tulio is fed up with the mixed signals Miguel is sending him and is out to find out what's going on. However, when he stumbles upon his partner in a rather compromising position, things make quite a bit more sense. Miguel/Tulio, very brief Miguel/OC.
Road to Eldorado - Rated: T - English - Friendship/Romance - Chapters: 1 - Words: 1,777 - Reviews: 8 - Favs: 63 - Follows: 7 - Published: 8/2/2011 - Tulio, Miguel - Complete
Glee meets Glee by babeitscoldoutside reviews
The kids in Glee club really wonder what's on that DVD in the choir club that says 'Glee Season 1 & 2'. SO they diceide to watch it - and are shocked.
Glee - Rated: K+ - English - Hurt/Comfort/Friendship - Chapters: 1 - Words: 4,506 - Reviews: 40 - Favs: 153 - Follows: 94 - Published: 8/2/2011 - Kurt H., Blaine A.
Take Back The Beat In Your Heart by rayychel infinity reviews
"Five times Blaine used MAC's Studio Finish SPF 35 in NC45 and one time that he finally didn't." Blaine lives a life of abuse and concealment until Kurt comes around.
Glee - Rated: T - English - Angst/Drama - Chapters: 1 - Words: 6,657 - Reviews: 17 - Favs: 72 - Follows: 7 - Published: 8/1/2011 - Blaine A., Kurt H. - Complete
the fear by gameboycolor reviews
He weakly cries for them to stop, only to be met with a concerned pair of eyes, mouth obscured by a surgical mask. Blaine, Pre-Dalton
Glee - Rated: T - English - Angst - Chapters: 1 - Words: 596 - Reviews: 2 - Favs: 3 - Follows: 2 - Published: 8/1/2011 - Blaine A. - Complete
Three wishes by MissLibertine reviews
Burt was sleeping in the in the upstairs bedroom, the house was in silence and drunk people sometimes have their conditions to act. Missing scene between Blaine and Kurt after Rachel's party. One-shot.
Glee - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 2,403 - Reviews: 5 - Favs: 24 - Follows: 3 - Published: 7/21/2011 - Blaine A., Kurt H. - Complete
Never Too Late by Scarlett Rogue reviews
Blaine is in trouble, and he has no one to go to- after all, who would believe that Dalton's Dean sexually abused a student? So he turns to a peer counseling website to help him get through each day. And that's when he meets his angel.
Glee - Rated: T - English - Hurt/Comfort/Drama - Chapters: 8 - Words: 16,522 - Reviews: 126 - Favs: 175 - Follows: 185 - Updated: 7/20/2011 - Published: 1/15/2011 - Blaine A., Kurt H. - Complete
Death drink by miamac reviews
Blaine's always felt like he came second to his father's drinking habits. Having to look after himself from a young age and his father's torment has turned him into the person he is today. How will Blaine tell him that he's gay?
Glee - Rated: M - English - Hurt/Comfort - Chapters: 1 - Words: 1,280 - Reviews: 2 - Favs: 3 - Follows: 4 - Published: 7/20/2011 - Blaine A.
Take A Big Gulp by ellemedit reviews
Blaine gets a week-long McKinley welcome on the first days of his transfer. Each day is a new slushie, and each slushie is a new flavor. Warning: violence, mentions of Sadie Hawkins dance.
Glee - Rated: T - English - Romance/Hurt/Comfort - Chapters: 1 - Words: 944 - Reviews: 16 - Favs: 31 - Follows: 8 - Published: 7/20/2011 - Blaine A., Kurt H. - Complete
Finding Yourself by purplepeony reviews
Blaine's thoughts while dressing for prom.
Glee - Rated: K - English - Angst - Chapters: 1 - Words: 1,670 - Reviews: 6 - Favs: 12 - Follows: 2 - Published: 7/19/2011 - Blaine A., Kurt H. - Complete
Good Boy by Phantom of a Rose reviews
The 'Humdel' family gets a puppy. Kurt notices some similarities between the new puppy and his boyfriend... KLAINE, Fluffy
Glee - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 2,293 - Reviews: 40 - Favs: 262 - Follows: 22 - Published: 7/19/2011 - Kurt H., Blaine A. - Complete
Knowing Nothing by MarynMoriarty reviews
2 years after meeting Reed Spencer, the team investigates a series of murders in which mental patients relatives are being killed. Who will they find, and who are the real targets, the relatives or the patients. sequel to Knowing Everything. Please R&R.
Criminal Minds - Rated: T - English - Suspense/Supernatural - Chapters: 14 - Words: 11,047 - Reviews: 49 - Favs: 15 - Follows: 6 - Updated: 7/18/2011 - Published: 1/20/2011 - S. Reid
The Light Shines Through by everything-is-eninalus reviews
Morgan is upset when Reid shows up to work with a hickey... From a guy. Good news: Morgan likes men too, specifically Reid. Bad news: Reid is currently dating Jasper from archives. Ugh.
Criminal Minds - Rated: M - English - Humor/Drama - Chapters: 5 - Words: 12,542 - Reviews: 81 - Favs: 199 - Follows: 69 - Updated: 7/17/2011 - Published: 7/13/2011 - D. Morgan, S. Reid - Complete
Kurt Wouldn't Cheat on Blaine by Kaeru Basho reviews
What exactly did Quinn mean when she said, "Kurt wouldn't cheat on Blaine"? This is exactly how she saw them. Spoilers to 2x19 Rumours. 2nd installment of "Klaine: As Told By..." Anthology. KLAINE & probably a little bit of FUINN. Fluff alert!
Glee - Rated: T - English - Romance/Friendship - Chapters: 5 - Words: 7,677 - Reviews: 55 - Favs: 185 - Follows: 121 - Updated: 7/15/2011 - Published: 7/3/2011 - Kurt H., Blaine A. - Complete
Gone in the Night by Laurella reviews
Reid kept his daughter a secret from the team. But after she is abducted from her own bed, he has to tell the team. The team won't let him face this alone. They decide to help
Criminal Minds - Rated: T - English - Crime/Hurt/Comfort - Chapters: 27 - Words: 43,008 - Reviews: 254 - Favs: 449 - Follows: 233 - Updated: 7/14/2011 - Published: 12/19/2010 - S. Reid - Complete
Alive by wombat blainers reviews
They don't notice when Kurt's fingernails dig in so deep that blood escapes through the tiny scratches, so they definitely don't notice when Kurt kicks it up a notch. TRIGGER WARNING: MAY GIVE IMPULSE TO SELF HARM. READ AT OWN RISK.
Glee - Rated: T - English - Hurt/Comfort/Angst - Chapters: 1 - Words: 1,031 - Reviews: 10 - Favs: 27 - Follows: 13 - Published: 7/14/2011 - Kurt H., Blaine A.
Daddy Dearest by h.wood reviews
Blaine has a rough relationship with his father, and Kurt is always there to comfort him no matter what.
Glee - Rated: K+ - English - Angst/Family - Chapters: 5 - Words: 3,660 - Reviews: 18 - Favs: 25 - Follows: 47 - Updated: 7/14/2011 - Published: 7/7/2011 - Blaine A., Kurt H.
Choices by lastcrazyhorn reviews
Unsub kidnaps Hotch and Reid. They have to have sex to get out of there in one piece. Non-Con Bottom!Hotch
Criminal Minds - Rated: M - English - Angst/Horror - Chapters: 1 - Words: 4,380 - Reviews: 36 - Favs: 145 - Follows: 39 - Published: 7/11/2011 - A. Hotchner/Hotch, S. Reid - Complete
Morning Starshine by CodeREDBazooka reviews
Derek decides to ambush Spencer in the shower.
Criminal Minds - Rated: T - English - Romance/Friendship - Chapters: 1 - Words: 1,955 - Reviews: 14 - Favs: 96 - Follows: 15 - Published: 7/7/2011 - S. Reid, D. Morgan - Complete
Kittens by JustJasper reviews
Prentiss comes home to kittens being born in her kitchen. Fluff.
Criminal Minds - Rated: K - English - Romance - Chapters: 1 - Words: 2,054 - Reviews: 17 - Favs: 77 - Follows: 7 - Published: 7/7/2011 - E. Prentiss, S. Reid - Complete
Reunion by Nuage14 reviews
Reid is going to his fifteen year high school reunion, but Garcia made sure the genius was not alone. She sent JJ along for the ride. OneShot.
Criminal Minds - Rated: K+ - English - Drama/Romance - Chapters: 1 - Words: 6,043 - Reviews: 12 - Favs: 246 - Follows: 43 - Published: 7/6/2011 - S. Reid, Jennifer J./JJ - Complete
Hello, Seattle by White Firebird reviews
Sequel to Truth & Consequences. Now that they're together, Sam and Freddie think that nothing can come between them...but life can be very cruel. And the twists that it takes aren't always ones you can see. It's going to be a rainy summer in Seattle...
iCarly - Rated: T - English - Romance/Hurt/Comfort - Chapters: 8 - Words: 34,147 - Reviews: 71 - Favs: 26 - Follows: 28 - Updated: 7/6/2011 - Published: 1/14/2010 - Sam P., Freddie B.
LoVeLy LeTtErS by Phantom Freedom reviews
"Mine." He whispered, with sureness to his tone. I nodded and kissed him gently… He lifted his face and gave me a glowing smile. "Yours." He breathed, kissing me chastely. Cute little one-shot in which only two words are spoken. Slash. Hotch/Reid.
Criminal Minds - Rated: K+ - English - Romance - Chapters: 1 - Words: 861 - Reviews: 11 - Favs: 62 - Follows: 13 - Published: 7/5/2011 - A. Hotchner/Hotch, S. Reid - Complete
Hunger by Bubblegum Rock Princess reviews
Blaine has a secret. A bit of summer angst. WARNING: eating disorders
Glee - Rated: T - English - Hurt/Comfort/Angst - Chapters: 4 - Words: 6,798 - Reviews: 18 - Favs: 54 - Follows: 24 - Updated: 6/28/2011 - Published: 6/21/2011 - Blaine A., Kurt H. - Complete
Little Earthquakes by LoriHuCalmia reviews
Kurt has hurt Blaine in one of the worst ways possible, he just doesn't know it yet. What happens when he does? Warnings for sexual and physical violence. Sequel to Emma CS Me's INCREDIBLE "Acting is Just Pretentious, Temporary Suicide." 1st in L-verse.
Glee - Rated: M - English - Hurt/Comfort/Romance - Chapters: 5 - Words: 11,636 - Reviews: 31 - Favs: 34 - Follows: 38 - Updated: 6/28/2011 - Published: 6/18/2011 - Blaine A., Kurt H. - Complete
The Trees by LittleMissMollah reviews
In which Blaine has an alcoholic father and Kurt is there to help. Rated M for description of abusive situations and use of alcohol. Please read and review! Whether it's praise or critique, any and all reviews are welcome.
Glee - Rated: M - English - Hurt/Comfort/Friendship - Chapters: 1 - Words: 2,220 - Reviews: 4 - Favs: 10 - Follows: 1 - Published: 6/25/2011 - Blaine A., Kurt H. - Complete
Concrete Jungle Where Dreams Are Made Of by BreeZombiee reviews
Kurt would always remember June 24, 2011, because it was the day he finally realized that he could marry his prince.
Glee - Rated: K+ - English - Romance/Hurt/Comfort - Chapters: 1 - Words: 828 - Reviews: 32 - Favs: 72 - Follows: 4 - Published: 6/24/2011 - Kurt H., Blaine A. - Complete
What My Papa Said by Wings of Writing reviews
Blaine's always looked to make his father proud and wanted his approval but never found it. A poem exploring Blaine's relationship with his father. I know it's a poem but give it a chance.
Glee - Rated: K+ - English - Family/Poetry - Chapters: 1 - Words: 351 - Reviews: 5 - Favs: 7 - Follows: 2 - Published: 6/24/2011 - Blaine A., Kurt H. - Complete
Loneliness by CatCompanion09 reviews
What happens when the stress of the bullying gets to be too much for Kurt? WARNING: TRIGGER ALERT- GRAPHIC MENTIONS OF CUTTING
Glee - Rated: M - English - Angst/Hurt/Comfort - Chapters: 1 - Words: 1,683 - Reviews: 12 - Favs: 51 - Follows: 8 - Published: 6/24/2011 - Blaine A., Kurt H. - Complete
Spencer Snaps by lazywriter123 reviews
This is Reid without coffee. Rated M for some BAD language and rude comments.
Criminal Minds - Rated: M - English - Humor - Chapters: 4 - Words: 2,168 - Reviews: 63 - Favs: 117 - Follows: 34 - Updated: 6/23/2011 - Published: 2/10/2010 - S. Reid - Complete
Convincing Mr Anderson by danrdarrenc reviews
Kurt attempts to convince Mr. Anderson to spend Father's Day with Blaine. Two-shot.
Glee - Rated: K+ - English - Chapters: 2 - Words: 1,868 - Reviews: 5 - Favs: 27 - Follows: 12 - Published: 6/20/2011 - Blaine A., Kurt H. - Complete
The Things that Fathers Do by Chloe Winchester reviews
Kurt and Blaine had very different fathers, and all Blaine wants is to know what having a good one feels like. Happy late Father's day! EmotionallyHurtAbused!Blaine Klaine and BurtBlaine!Bonding!
Glee - Rated: T - English - Hurt/Comfort/Romance - Chapters: 1 - Words: 2,056 - Reviews: 33 - Favs: 160 - Follows: 14 - Published: 6/20/2011 - Kurt H., Blaine A. - Complete
You Came For Me by violetismyalias reviews
Blaine has been training to kill ever since arriving at Dalton, so when the Zombie Apocalypse starts in Lima, Ohio, he will do everything in his power to protect Kurt. AU. Based on reidavidson's drawing on tumblr. Link in fic . Possible two-shot.
Glee - Rated: T - English - Romance/Adventure - Chapters: 1 - Words: 3,184 - Reviews: 12 - Favs: 24 - Follows: 23 - Published: 6/18/2011 - Blaine A., Kurt H.
Genovia's Prince by TwirlsWrites reviews
Kurt is the heir to the throne in Genovia. "Well I always knew you were my prince, I just didn't realize you were an actual one." To Kurt's mortification he felt his face flush. "Blaine, that was so cheesy."
Glee - Rated: T - English - Humor - Chapters: 4 - Words: 9,611 - Reviews: 27 - Favs: 61 - Follows: 125 - Updated: 6/16/2011 - Published: 5/30/2011 - Kurt H., Blaine A.
Man Up, Benson by Linwe-Amari reviews
"You," she proclaimed, "are my dork." She then proceeded to grab the back of Freddie's neck and slammed her lips into his, kissing the fudge out of him.-*-The story of how Freddie Benson proposed to Sam Puckett and got pantsed on the peak of Mount Katahdin.
iCarly - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 3,350 - Reviews: 16 - Favs: 55 - Follows: 4 - Published: 6/10/2011 - Freddie B., Sam P. - Complete
Zombies? Are you kidding me? by mattythemessenger reviews
It was a normal day at Mckinely. Well it was until the undead barged in and ruined everything.
Glee - Rated: T - English - Adventure/Humor - Chapters: 1 - Words: 2,224 - Reviews: 6 - Favs: 4 - Follows: 16 - Published: 6/10/2011 - Kurt H., Blaine A.
Need a Ride? by Shadow Sakura reviews
A few of the agents find out Reid has a girlfriend, and she's not quite what they expected. Reid/OC. While new chapters will be added as I write them, they are all one-shots, and as such it is marked as complete.
Criminal Minds - Rated: T - English - Romance/Humor - Chapters: 2 - Words: 2,526 - Reviews: 31 - Favs: 207 - Follows: 76 - Updated: 6/7/2011 - Published: 5/31/2011 - S. Reid - Complete
No Fear by Linwe-Amari reviews
"I'm not sorry that we went on a date, Sam. I'm not sorry that I took you home, or followed you into your house through your window, and I'm not sorry that I've been here at the hospital with you for the last day and a half. I am not sorry that I may be in love with you. I am not freaking sorry. Not one bit."
iCarly - Rated: T - English - Drama/Romance - Chapters: 1 - Words: 5,765 - Reviews: 4 - Favs: 14 - Follows: 2 - Published: 6/3/2011 - Freddie B., Sam P. - Complete
Reid's Little Secret by Shadow Sakura reviews
The BAU returns from Lila Archer's case to find a surprise waiting at Reid's desk. Reid/OC.
Criminal Minds - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 950 - Reviews: 39 - Favs: 391 - Follows: 113 - Published: 6/2/2011 - S. Reid - Complete
The End of the Tunnel by randomee reviews
There is a disease where if you show the symptom, they will take you away, never to be seen again. One day, Blaine wakes up to discover he has the disease.
Glee - Rated: M - English - Supernatural/Angst - Chapters: 7 - Words: 20,643 - Reviews: 22 - Favs: 40 - Follows: 29 - Updated: 5/31/2011 - Published: 5/6/2011 - Blaine A., Kurt H. - Complete
Some People by Chloe Winchester reviews
Kurt wasn't sure how his audition for Nationals went, so he consults his best friend and boyfriend to see what he thinks. KLAINE!
Glee - Rated: T - English - Romance - Chapters: 1 - Words: 1,378 - Reviews: 10 - Favs: 51 - Follows: 4 - Published: 5/30/2011 - Kurt H., Blaine A. - Complete
Midnight by ThatYellowBear reviews
REWRITE! Original summary : Raven is attacked by one of Slade's creatures. Now a slow change is coming over her. Will Beast Boy notice before it is too late? RaexBB xxTerrabashingxx but not that much. New summary inside.
Teen Titans - Rated: T - English - Romance/Supernatural - Chapters: 12 - Words: 26,180 - Reviews: 82 - Favs: 58 - Follows: 55 - Updated: 5/29/2011 - Published: 8/18/2009 - Beast Boy, Raven
This Ain't A Fairytale by Anime Girl23 reviews
It wasn't abuse. Puck didn't know what it was, but it wasn't abuse. Anyone that said it was was a liar. Quinn. Santana. Kurt. Everyone. Puck/OMC and Puck/Kurt slash
Glee - Rated: T - English - Angst/Hurt/Comfort - Chapters: 1 - Words: 984 - Reviews: 14 - Favs: 52 - Follows: 12 - Published: 5/27/2011 - Puck, Kurt H. - Complete
Sometimes You Need More Than Courage by xSlythStratasfaction reviews
After having another one of his terrible recurring nightmares, Kurt is consoled by Blaine. It is during this consolation that Kurt realizes that he really knows absolutely nothing about Mr. Blaine Anderson. So, what's the backstory behind this dreamboat?
Glee - Rated: M - English - Romance/Angst - Chapters: 16 - Words: 60,227 - Reviews: 141 - Favs: 148 - Follows: 143 - Updated: 5/26/2011 - Published: 4/12/2011 - Kurt H., Blaine A. - Complete
Listen To Me by Thoughts of a Fallen Angel reviews
During and Post-Comeback episode, with a few tweeks from your truly. Dang it, but Blaine won't listen to Kurt on the subject of whether he likes boys, or girls. Lots of sweetness, enjoy! R&R PLEASE! :3
Glee - Rated: M - English - Romance/Angst - Chapters: 1 - Words: 9,406 - Reviews: 10 - Favs: 23 - Follows: 2 - Published: 5/25/2011 - Kurt H., Blaine A. - Complete
Animal Enough by WolfBloodBaptism reviews
Beast Boy comes to Cyborg with a problem. Why is he so agitated? What advise does Robin give Raven? Is Beast Boy finally animal enough for Raven?
Teen Titans - Rated: K+ - English - Drama/Humor - Chapters: 3 - Words: 1,168 - Reviews: 25 - Favs: 38 - Follows: 7 - Updated: 5/24/2011 - Published: 7/23/2010 - Beast Boy, Raven - Complete
Perfect by Suzette's Blue reviews
Kurt was perfect and that's all there was to it. Birthday fic for Angel. Trigger warning: contains self harm. Rated for themes and language.
Glee - Rated: T - English - Angst - Chapters: 1 - Words: 2,085 - Reviews: 6 - Favs: 11 - Follows: 1 - Published: 5/23/2011 - Kurt H. - Complete
Heart and Soul by Chloe Winchester reviews
Blaine shows up on Kurt's doorstep soaked and beaten, and all he wants is someone to hold him. Klaine! Hurt!Blaine ConcernedCaring!Kurt
Glee - Rated: T - English - Hurt/Comfort/Romance - Chapters: 1 - Words: 3,080 - Reviews: 49 - Favs: 276 - Follows: 32 - Published: 5/23/2011 - Blaine A., Kurt H. - Complete
I've got the Best of Both Teenage Dreams by 494ELB reviews
Wevid want to see McKinley New Directions perform out of competition, it's only fair! Klaine fluff, with an extra dollop of cheese on the side.
Glee - Rated: T - English - Romance - Chapters: 1 - Words: 3,005 - Reviews: 3 - Favs: 63 - Follows: 17 - Published: 5/19/2011 - Kurt H., Blaine A.
Time is of the Essence by Foozeezoos reviews
The BAU team is working on a case of murders, when Reid is kidnapped. They are told they have a limited time to save him, so they have to race against the clock.
Criminal Minds - Rated: T - English - Suspense/Hurt/Comfort - Chapters: 12 - Words: 23,756 - Reviews: 85 - Favs: 140 - Follows: 67 - Updated: 5/17/2011 - Published: 8/14/2010 - S. Reid - Complete
Will I Wake Tomorrow? by jetsfanforlyfe reviews
"While we were waiting for his dad to pick us up, these three guys-um-beat the living crap out of us." The fall out from Blaine's Sadie Hawkins Dance nightmare, and the conversations that lead to his transfer to Dalton.
Glee - Rated: T - English - Hurt/Comfort/Angst - Chapters: 1 - Words: 5,582 - Reviews: 12 - Favs: 49 - Follows: 7 - Published: 5/11/2011 - Blaine A. - Complete
iHad a Dream by flameh reviews
Sam is in a deep sleep, or is she? It’s late at night and the three friends get back from the drive-in, they watch some TV drink some iced tea, and head off to bed. Carly took the couch, Sam her bed and Freddie went home, right? Read and find out. Seddie
iCarly - Rated: T - English - Humor/Romance - Chapters: 7 - Words: 2,749 - Reviews: 27 - Favs: 9 - Follows: 14 - Updated: 5/3/2011 - Published: 8/9/2009 - Freddie B., Sam P.
Riff Raff and the Ghost by Sofricus Aurora Zakuro reviews
To prevent another Rocky Horror debacle, the kids are forced to work at a haunted house. Unfortunately, somebody made the mistake of letting Sam plan the whole thing. KLAINE.
Glee - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 1,318 - Reviews: 3 - Favs: 50 - Follows: 5 - Published: 5/2/2011 - Blaine A., Kurt H. - Complete
A History I've Hidden by theembarrassingone reviews
Blaine is such an annoyingly perfect person. It appears he has no flaws. So what is it that he hide behind that never ending smile? Basically my story of what could be Blaine's past. Rated for language and mention of rape. Takes place after BTW.
Glee - Rated: T - English - Chapters: 1 - Words: 5,972 - Reviews: 8 - Favs: 30 - Follows: 6 - Published: 4/30/2011 - Blaine A., Kurt H. - Complete
Prelude by Gleekmom33 reviews
The way their perfect "coming out" event should start... Rated T for events in future chapters.. I do not own GLEE Please review! Thanks!
Glee - Rated: T - English - Romance - Chapters: 14 - Words: 25,839 - Reviews: 34 - Favs: 101 - Follows: 68 - Updated: 4/27/2011 - Published: 3/29/2011 - Blaine A., Kurt H. - Complete
Born This Way by PoppyandViolet reviews
What if it was The Warblers who were performing Born This Way instead of New Directions? What if David decided to make some alterations to Blaine's costume? Fluffy Klaine one-shot.
Glee - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 3,330 - Reviews: 18 - Favs: 126 - Follows: 25 - Published: 4/26/2011 - Blaine A., Kurt H. - Complete
Be All Right by BigDestiny reviews
It was the phone call Burt Hummel had been waiting for, and dreading. "Dad, would it be okay if Blaine defiled me tonight?" Burt has a lot to think about when a sudden snowstorm presents Kurt with an opportunity with Blaine.
Glee - Rated: T - English - Family/Angst - Chapters: 1 - Words: 1,873 - Reviews: 12 - Favs: 36 - Follows: 5 - Published: 4/21/2011 - Burt H., Kurt H. - Complete
Pain in Amplification by Eternal Soldier reviews
Sequel to A Secret Love, 3rd in Reid/Morgan SLASH series. Two months later, and Reid and Morgan are happy as ever with the team's support. But when an UnSub releases a deadly virus and one of them becomes infected, could illness and death tear them apart?
Criminal Minds - Rated: T - English - Angst/Romance - Chapters: 1 - Words: 15,424 - Reviews: 17 - Favs: 210 - Follows: 40 - Published: 4/19/2011 - S. Reid, D. Morgan - Complete
Why Do You Get to Be Prince Charming? by Cassie Daye reviews
...in which Blaine and Kurt lose a bet against David and Wes... Chapter two now posted...in which Blaine and Kurt plan round two... Blaine/Kurt David/Wes
Glee - Rated: K+ - English - Humor/Romance - Chapters: 3 - Words: 2,163 - Reviews: 28 - Favs: 49 - Follows: 49 - Updated: 4/14/2011 - Published: 2/9/2011 - Blaine A., Kurt H. - Complete
Glee Goes Facebook by SinfulPerfection reviews
The second season of Glee as told by Facebook! Basically what the character's Facebooks might have said during each episode. Each chapter corresponds to an episode in order in the second season. Rated T, spoilers.
Glee - Rated: T - English - Humor - Chapters: 4 - Words: 11,078 - Reviews: 24 - Favs: 37 - Follows: 37 - Updated: 4/13/2011 - Published: 4/5/2011
I Think I Like It by YourBlueCastle reviews
"And you want to know how it feels? Sickening. Gut wrenching, bile rising, mind blowing, heart fluttering sickening. Because how in the world could a guy ever make you feel this way?" At the risk of being highly unoriginal, here's an iOMG fanfic. R&R
iCarly - Rated: K+ - English - Romance - Chapters: 1 - Words: 703 - Reviews: 13 - Favs: 27 - Follows: 2 - Published: 4/11/2011 - Sam P., Freddie B. - Complete
Made a Wrong Turn by Mrs. Cedric Cullen reviews
Oneshot. Kurt never thought he'd be doing this to himself, yet he also never thought that no one would notice. WARNING: Explicit descriptions of self-harm. Don't like, don't read. Possible triggers. Rating just to be safe. Epilogue added!
Glee - Rated: M - English - Angst - Chapters: 2 - Words: 2,623 - Reviews: 14 - Favs: 23 - Follows: 8 - Updated: 4/7/2011 - Published: 4/6/2011 - Kurt H. - Complete
These Violent Delights by dresdendollontheprowl reviews
But I don't regret a moment, Tulio, not a single moment.
Road to Eldorado - Rated: M - English - Romance/Drama - Chapters: 1 - Words: 4,815 - Reviews: 11 - Favs: 29 - Follows: 3 - Published: 4/6/2011 - Miguel, Tulio
The new director by flyin'rabbit reviews
The Warblers find out who Aural Intensity's new director is, and Kurt is the only one who seems to find this alarming. Chapter 8: Finn gets a call, the group is caught, and the story reaches the end.
Glee - Rated: K+ - English - Friendship/Humor - Chapters: 8 - Words: 12,764 - Reviews: 47 - Favs: 122 - Follows: 100 - Updated: 4/5/2011 - Published: 2/16/2011 - Kurt H., Blaine A. - Complete
We've got all the time by spinlight reviews
Things transpire, relationships shift when the gang is stuck inside the apartment building for the span of a three day storm. Seddie.
iCarly - Rated: T - English - Romance/Humor - Chapters: 5 - Words: 17,271 - Reviews: 70 - Favs: 120 - Follows: 51 - Updated: 4/4/2011 - Published: 8/15/2009 - Freddie B., Sam P. - Complete
Illusions for our Youth by glittergrownup reviews
Kurt learns the hard way that the idyllic childhood must end at some point. A tough and dangerous lesson about life in the real world. Warning, there may be triggering material for victims of sexual assault.
Glee - Rated: M - English - Angst - Chapters: 1 - Words: 3,006 - Reviews: 3 - Favs: 9 - Published: 4/2/2011 - Kurt H. - Complete
This is Your Fault, Benson by Linwe-Amari reviews
"Fredward Benson, I'm going to cut off your Lincoln Log and feed it to you at dinner tonight!" she screams at me. ...Perfect. Seddie. One-shot.
iCarly - Rated: T - English - Romance/Family - Chapters: 1 - Words: 1,773 - Reviews: 22 - Favs: 52 - Follows: 1 - Published: 4/1/2011 - Freddie B., Sam P. - Complete
A Comet Appears by lifeluver reviews
A high, persistent beeping interrupts his dreams of summer love and musicals and picnics in the grass until the sun goes down. Warning: Character death
Glee - Rated: T - English - Angst/Friendship - Chapters: 1 - Words: 10,210 - Reviews: 34 - Favs: 69 - Follows: 4 - Published: 3/29/2011 - Blaine A., Kurt H.
Visions of Rain by teacandles reviews
How can you hang on when he doesn't even know you're there? Blaine finds out the true meaning of love when something happens to Kurt.
Glee - Rated: T - English - Angst/Family - Chapters: 39 - Words: 62,265 - Reviews: 363 - Favs: 227 - Follows: 262 - Updated: 3/28/2011 - Published: 12/17/2010 - Blaine A., Kurt H. - Complete
I've Worn That Face by Cleo Leo reviews
An AU Fic that branches out from the episode 'Silly Love songs'. Written before episode was aired so it's doesn't follow canon. Kurt/OC Flint. FLIRT. Klaine Friendship, one-sided Klaine, on both sides. Frienship is hard, love can be harder.
Glee - Rated: T - English - Romance/Hurt/Comfort - Chapters: 23 - Words: 54,764 - Reviews: 603 - Favs: 291 - Follows: 254 - Updated: 3/25/2011 - Published: 2/5/2011 - Kurt H., Blaine A. - Complete
Cabin Fever by Dreaming-Of-A-Nightmare reviews
Carole, at work, wins a raffle to go on vacation to a ski resort in Colorado. However, Paul Karofsky wins the same thing at his workplace for his own family. And as it happens... the two families must share a cabin. .:. a five-part Kurtofsky fic.
Glee - Rated: T - English - Humor/Romance - Chapters: 5 - Words: 21,254 - Reviews: 109 - Favs: 124 - Follows: 72 - Updated: 3/23/2011 - Published: 3/20/2011 - Kurt H., D. Karofsky - Complete
A Tale of Lady Sweaters by dinkydiddydums reviews
"I have to say, I picked the wrong day to wear it. It's far too cold out for these one-shouldered things." Kurt tugged uselessly at fabric hanging over his shoulder in an attempt to get it to cover more of his skin. Blaine whimpered from behind him.
Glee - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 1,800 - Reviews: 29 - Favs: 167 - Follows: 16 - Published: 3/20/2011 - Blaine A., Kurt H. - Complete
Sleep Talking Rambles by LaPaige reviews
Kurt Hummel has a tendency to sleepwalk. Blaine doesn't know this, until he experiences it for himself. Or: In which Kurt is the Black Swan, Blaine is a hobbit and there is a double rainbow. No spoilers.
Glee - Rated: K+ - English - Humor/Romance - Chapters: 1 - Words: 1,653 - Reviews: 31 - Favs: 92 - Follows: 8 - Published: 3/20/2011 - Blaine A., Kurt H. - Complete
Never Have I Ever by Fred-Weasley-Isn't-Dead reviews
An innocent game of Never Have I Ever goes horribly wrong. Trigger warning: Talk of self-harm
Glee - Rated: T - English - Angst/Hurt/Comfort - Chapters: 1 - Words: 1,265 - Reviews: 21 - Favs: 238 - Follows: 45 - Published: 3/16/2011 - Kurt H., Blaine A. - Complete
Shipwrecked by Looka'sMagicHell reviews
I'm Sam Manson. Me and seven other people went on a school cruise, only to get stuck in a thunderstorm. We crashed on an island with no location on a map, and no history. Oh, and have I mentioned there are dinosaurs on this island? COMPLETE! XD
Danny Phantom - Rated: T - English - Adventure/Romance - Chapters: 17 - Words: 59,075 - Reviews: 125 - Favs: 174 - Follows: 82 - Updated: 3/14/2011 - Published: 11/27/2009 - Sam M., Danny F. - Complete
Yo Ho and a Bottle of Scotch by Linwe-Amari reviews
Yeah, it probably wasn't the best idea to go alone to a party with people who didn't give about her or her safety, but at the time, Sam had not been thinking straight... Seddie. One-shot.
iCarly - Rated: T - English - Drama/Romance - Chapters: 1 - Words: 2,611 - Reviews: 10 - Favs: 23 - Follows: 1 - Published: 3/9/2011 - Freddie B., Sam P. - Complete
FiveAlarm Headaches by LinaBeal reviews
Set post-"It's a leaf" the 2March2011 episode . Fuller and Minard show up to work at the Clinic the day after their serious fiesta. Mina/Tommy. rated for makeout.
Off the Map - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 781 - Reviews: 3 - Favs: 6 - Follows: 2 - Published: 3/5/2011 - Mina M., Tommy F. - Complete
Ok is Wonderful by TabB reviews
Wevid fic with Klaine. Wevid needs more love! Wes's party leads to a game of Truth or Dare which secrets are revealed, and not just through the truths.
Glee - Rated: T - English - Friendship/Romance - Chapters: 1 - Words: 3,204 - Reviews: 11 - Favs: 71 - Follows: 10 - Published: 3/4/2011 - David, Wes - Complete
Scratches and Ranebows by PolkaMusic reviews
Reed decides to brave up and give Shane one unforgettable birthday present. CP Coulter's Daltonverse! ReedXShane smut. I think that if they did have sex then this is how it would happen, with Shane more concerned about Reed's pleasure than his.
Glee - Rated: M - English - Romance/Humor - Chapters: 1 - Words: 5,281 - Reviews: 43 - Favs: 167 - Follows: 5 - Published: 2/27/2011 - Dalton Academy Warblers - Complete
Cut by andersex reviews
Everyone has their demons...Blaine Anderson's are just easier to hide. Warning: Major Triggers
Glee - Rated: T - English - Angst/Hurt/Comfort - Chapters: 1 - Words: 2,149 - Reviews: 7 - Favs: 20 - Follows: 5 - Published: 2/22/2011 - Blaine A., Kurt H. - Complete
On Deaf Ears by StarShinobi reviews
A different way Furt could have ended. Kurt doesn't want to go to Dalton and leave everything he has a McKinley behind. Burt decides to have a talk with Figgins about protecting Kurt but if that goes wrong... Burt/Kurt Father/son relationship.
Glee - Rated: T - English - Family/Hurt/Comfort - Chapters: 1 - Words: 4,866 - Reviews: 13 - Favs: 59 - Follows: 7 - Published: 2/21/2011 - Burt H., Kurt H. - Complete
Little Spoons and Romance Novels by HeartsHungBehind reviews
Klaine fluff, some smut. Kurt has a secret passion for romance novels. Can Blaine use that to sweep him off his feet? Rated T for minor cursing and boy kisses.
Glee - Rated: T - English - Romance/Humor - Chapters: 5 - Words: 4,194 - Reviews: 47 - Favs: 81 - Follows: 62 - Updated: 2/18/2011 - Published: 2/3/2011 - Blaine A., Kurt H. - Complete
Not So Wonderful Reminders by GleeFangurl721 reviews
A second try at a previous story of mine. Dalton gets a slushie machine but Kurt isn't to happy. Wevid Klaine SLASH
Glee - Rated: T - English - Hurt/Comfort/Friendship - Chapters: 1 - Words: 1,058 - Reviews: 7 - Favs: 96 - Follows: 21 - Published: 2/18/2011 - Blaine A., Kurt H. - Complete
Interrupted by S.H.Nessa reviews
Kurt and Blaine just can't seem to get any privacy. Klaine, with appearances by other characters. Drabble series. SMUT warning, final chapter.
Glee - Rated: M - English - Romance/Humor - Chapters: 8 - Words: 11,463 - Reviews: 59 - Favs: 173 - Follows: 99 - Updated: 2/15/2011 - Published: 1/30/2011 - Blaine A., Kurt H. - Complete
Trophy by ChuckNorrisLeftFist reviews
In a darker AU, the winners freely prey on the losers. A loser becomes the winners' trophy. Dub-con. Update: The final chapter as the characters make life-changing decisions.
Glee - Rated: T - English - Drama/Angst - Chapters: 22 - Words: 48,928 - Reviews: 194 - Favs: 114 - Follows: 120 - Updated: 2/13/2011 - Published: 12/24/2010 - Blaine A., Kurt H. - Complete
Brought Up That Way by thesoundofsunshine reviews
Burt did not raise his son to be beaten up, or lowered into the ground. Kurt was simply not brought up that way.
Glee - Rated: T - English - Hurt/Comfort/Family - Chapters: 1 - Words: 4,292 - Reviews: 18 - Favs: 55 - Follows: 13 - Published: 2/11/2011 - Burt H., Kurt H. - Complete
Taken by irishchic799 reviews
While watching Henry, Reid and his godson are attacked and kidnapped by an unknown assailant. Will the team find them in time to save Reid and Henry or will tragedy strike their family?
Criminal Minds - Rated: T - English - Suspense - Chapters: 14 - Words: 15,856 - Reviews: 102 - Favs: 423 - Follows: 166 - Updated: 2/9/2011 - Published: 1/31/2011 - S. Reid - Complete
Peekaboo by Gleek Princess reviews
Will tends to miss things. Luckily for him, usually it's the little things he misses, and it doesn't matter much. But this. This is something he can't skim over with his eyes. Because this time, there will be consequences. Irrevocable ones.
Glee - Rated: T - English - Suspense/Angst - Chapters: 1 - Words: 1,608 - Reviews: 15 - Favs: 77 - Follows: 8 - Published: 2/8/2011 - Will S., Kurt H. - Complete
It Started As An Accident by RavenWriteWing reviews
Warning! This is the darkest thing I have ever written it has death, blood, swearing, and more. Mistakes, that's all that he was doing, messing up, failing, so he found a way to pay for his mistakes. Please read and review!
Teen Titans - Rated: T - English - Angst/Drama - Chapters: 1 - Words: 3,921 - Reviews: 17 - Favs: 20 - Follows: 3 - Updated: 2/6/2011 - Published: 1/27/2011 - Beast Boy, Raven - Complete
Just A Game by BreeZombiee reviews
"And suddenly Kurt was screaming, screaming and crying and trying to catch his breath and the room just froze." Drabble. Mentions of rape. Slight Puckurt if you squint.
Glee - Rated: T - English - Hurt/Comfort/Angst - Chapters: 1 - Words: 693 - Reviews: 22 - Favs: 124 - Follows: 30 - Published: 1/31/2011 - Kurt H. - Complete
Visions of Their Past by redshadow17 reviews
Robin has decided the team needs to be closer, so it's time for everyone to share their past...but maybe telling isn't enough, no we're going to show you! Hard core RaeBB possibly some StarRob and Cysomeone Can't remember right now . Rating just 2 b safe
Teen Titans - Rated: T - English - Chapters: 8 - Words: 7,376 - Reviews: 28 - Favs: 55 - Follows: 20 - Updated: 1/28/2011 - Published: 4/22/2010 - Raven, Beast Boy - Complete
Mack the Knife by DrPQJazz reviews
A killer has been unleasehed upon the Glee Club, who are dropping dead with nothing but Jazz in the air and in their cold still ears. Who is it? No central chracter, but Kurt is highlighted. First fan fic, please be gentle XD - It's over, thanks everyone!
Glee - Rated: T - English - Mystery/Suspense - Chapters: 15 - Words: 28,727 - Reviews: 79 - Favs: 26 - Follows: 27 - Updated: 1/24/2011 - Published: 12/23/2010 - Kurt H. - Complete
Held Hostage by 2Dglasses reviews
On the way to New York, the Glee Club is ambushed.
Glee - Rated: T - English - Suspense/Hurt/Comfort - Chapters: 19 - Words: 14,361 - Reviews: 164 - Favs: 194 - Follows: 125 - Updated: 1/23/2011 - Published: 12/7/2010 - Kurt H. - Complete
One Night by TwistedRocketPower reviews
Prison was never something he had written in his day planner. Being beaten by men twice his size was something he never imagined. He never meant to kill the girl he loved. He never meant to hurt his brother. His whole life changed, in one night.
Suite Life series - Rated: T - English - Drama/Angst - Chapters: 19 - Words: 26,136 - Reviews: 98 - Favs: 43 - Follows: 27 - Updated: 1/21/2011 - Published: 11/6/2010 - Cody M., Zack M. - Complete
Dollhouse by Emma CS Me reviews
Kurt thinks his boyfriend is beautiful, gorgeous and sexy. Andrew Carper thought his boy was beautiful. Trigger warning: abduction, sexual abuse, coercive sexual conduct.
Glee - Rated: M - English - Angst/Drama - Chapters: 1 - Words: 7,740 - Reviews: 18 - Favs: 92 - Follows: 15 - Published: 1/21/2011 - Kurt H., Blaine A. - Complete
See Me by Loverhusband reviews
A glimpse into Blaine's horrible past and a look at his possible future - with Kurt. Switches between Blaine POV/past chapters and Kurt POV/present chapters. Blaine goes to some very dark places. Kurt gets to be Prince Charming for a change.
Glee - Rated: T - English - Angst/Hurt/Comfort - Chapters: 9 - Words: 37,292 - Reviews: 103 - Favs: 90 - Follows: 155 - Updated: 1/19/2011 - Published: 12/19/2010 - Blaine A., Kurt H.
Knowing Everything by MarynMoriarty reviews
A new unsub is on the loose but now there is a 13 year old who knows everything about them, and apparently the case, when her and Dr. Reid are taken by the unsub will they be able to get out of it? no pairings RE-WRITTEN! please R&R
Criminal Minds - Rated: T - English - Supernatural/Suspense - Chapters: 11 - Words: 7,711 - Reviews: 33 - Favs: 17 - Follows: 11 - Updated: 1/19/2011 - Published: 1/10/2011 - S. Reid - Complete
Less of a Man by aussieflugel reviews
Blaine's little sister wants Kurt to help her with her make-up, and Kurt is only too willing to assist. Only thing is, Blaine's father isn't too impressed by this. Klaine.
Glee - Rated: T - English - Drama - Chapters: 1 - Words: 1,038 - Reviews: 11 - Favs: 67 - Follows: 12 - Published: 1/16/2011 - Blaine A., Kurt H. - Complete
Slushies and Snowball Fights by PinkGlasses reviews
Blaine tries to surprise Kurt with some winter fun, but Kurt reacts very unexpectedly. Fluffy Klaine one-shot
Glee - Rated: K+ - English - Romance/Friendship - Chapters: 1 - Words: 1,389 - Reviews: 5 - Favs: 44 - Follows: 7 - Published: 1/9/2011 - Kurt H., Blaine A. - Complete
Leaving Is Easy by Sweettweet07 reviews
She didn't see that it was red... He couldn't save her... 4 years of guilt, and he's still alone... but is he really?
Maid Sama! - Rated: K+ - English - Hurt/Comfort/Drama - Chapters: 7 - Words: 12,990 - Reviews: 76 - Favs: 76 - Follows: 32 - Updated: 1/8/2011 - Published: 12/19/2010 - T. Usui, Misaki A. - Complete
The Stars Can Wait For Your Sign by Emma CS Me reviews
Kurt's a little annoyed at Finn calling him at three AM and waking him up. It then proceeds to become the scariest conversation of his life. Trigger warning: suicide
Glee - Rated: T - English - Angst/Family - Chapters: 1 - Words: 3,937 - Reviews: 25 - Favs: 107 - Follows: 18 - Published: 1/6/2011 - Kurt H., Finn H. - Complete
Master's Toy by RaVeN.RoTh16 reviews
A sadistic, intergalactic hunter comes to Earth and WANTS Raven. Beast Boy doesn't like it one bit. The hunter is determined to get what he wants, but what happens when Beast Boy gets in the way? Pain, confusion, and WAFFLES! BB/Rae Rob/Star Cy/lonelines
Teen Titans - Rated: T - English - Romance/Horror - Chapters: 16 - Words: 52,185 - Reviews: 111 - Favs: 58 - Follows: 68 - Updated: 1/4/2011 - Published: 5/31/2009 - Raven, Beast Boy
iHave Hiccups by Sushihiro reviews
Freddie has the hiccups. Sam gets rid of them for him in the most Sam-ish way. Kissing ensues. This story was written in honor of this very date, two years ago on January 3rd 2009. A Seddie Kissaversary fic. One-shot!
iCarly - Rated: T - English - Humor/Romance - Chapters: 1 - Words: 1,706 - Reviews: 39 - Favs: 75 - Follows: 2 - Published: 1/3/2011 - Freddie B., Sam P. - Complete
To Every Bad Writer this Fandom has by Kissy Fishy reviews
Brace yourselves...
Phineas and Ferb - Rated: T - English - Humor/Angst - Chapters: 1 - Words: 2,609 - Reviews: 85 - Favs: 84 - Follows: 14 - Published: 12/28/2010 - Complete
Overheard From A Choir Room by lil-miss-chocolate reviews
The Glee clubbers overhear a compromising situation in the choir room.
Glee - Rated: T - English - Humor - Chapters: 1 - Words: 727 - Reviews: 9 - Favs: 70 - Follows: 10 - Published: 12/18/2010 - Kurt H., Puck - Complete
I Don't Like You by hislips reviews
She's cold and she's cruel and she had just said: "Baka Usui! I DON'T LIKE YOU!" Oh Misaki... What now? :D
Maid Sama! - Rated: T - English - Romance - Chapters: 1 - Words: 4,600 - Reviews: 37 - Favs: 151 - Follows: 21 - Updated: 12/15/2010 - Published: 9/14/2009 - T. Usui, Misaki A. - Complete
After Rain by Carina2602 reviews
Every year, the football team has annual party where every member of the team participates in a bonding exercise. Usually, it's just a night of drinking and an epic, creative prank. This year, it's something different.
Glee - Rated: M - English - Hurt/Comfort/Angst - Chapters: 4 - Words: 16,920 - Reviews: 45 - Favs: 166 - Follows: 92 - Updated: 12/13/2010 - Published: 11/2/2010 - Kurt H., Will S. - Complete
iDon't Deserve This by person226 reviews
Freddie asks Sam out. She agrees. Sam talks to her mother which leads to the beginning of Sam's doubts. On the night of their date, something terrible happens. Can they get through what happened and the life-changing aftermath?
iCarly - Rated: T - English - Drama/Romance - Chapters: 20 - Words: 69,399 - Reviews: 228 - Favs: 106 - Follows: 55 - Updated: 12/8/2010 - Published: 6/10/2010 - Freddie B., Sam P. - Complete
In Loco Parentis by Emma CS Me reviews
Burt's never liked Will Schuester. He admits it. But he likes the man a whole lot less once he notices Schuester's habit of touching his stepson.
Glee - Rated: T - English - Drama/Family - Chapters: 1 - Words: 4,486 - Reviews: 10 - Favs: 50 - Follows: 9 - Published: 12/7/2010 - Burt H., Finn H. - Complete
Protector by iolah reviews
The boys at Dalton had known Kurt had been bullied, they just hadn't known the extent of it until video-surfing through Jacob's blog. Kurt doesn't understand what the big deal is. Slight Klaine. In response to an angst!meme prompt.
Glee - Rated: T - English - Hurt/Comfort/Friendship - Chapters: 1 - Words: 2,382 - Reviews: 28 - Favs: 492 - Follows: 79 - Published: 12/6/2010 - Kurt H., Blaine A. - Complete
What's Right in Front of You by iCarlyAngst reviews
Sam's life is far from perfect, but she gets by with the help of her best friend Carly. Something traumatic happens and she has to turn to Freddie for help. The hatred subsides and they realized that there is something else there. Something more. AU/OOC
iCarly - Rated: M - English - Romance/Hurt/Comfort - Chapters: 29 - Words: 116,138 - Reviews: 446 - Favs: 357 - Follows: 143 - Updated: 11/21/2010 - Published: 4/19/2010 - Sam P., Freddie B. - Complete
Toil and Trouble by Emma CS Me reviews
Kurt starts developing mysterious bruises. He says they're just from accidents, but no-one who cares about him will believe that. /trigger warning: physical abuse.
Glee - Rated: T - English - Angst/Drama - Chapters: 1 - Words: 9,153 - Reviews: 28 - Favs: 119 - Follows: 22 - Published: 11/21/2010 - Kurt H., Finn H. - Complete
I Hate the Dentist by Emma CS Me reviews
Kurt Hummel isn't stupid. When the straight love of his life is drunk enough to sleep with him at a party, he's not going to stick around for the fallout. However, maybe he is stupid, because running away has consequences. Trigger warning - rape.
Glee - Rated: T - English - Angst/Drama - Chapters: 17 - Words: 25,166 - Reviews: 139 - Favs: 77 - Follows: 108 - Updated: 11/14/2010 - Published: 6/22/2010 - Kurt H., Finn H. - Complete
Promise Of A Lifetime by worldreminiscence reviews
...Usui Takumi. You promised me right? Where are you now then? Are you still here by my side? Can you see me crying now? Can you hear me whispering I love you? ...I ...hate you, you know... Misaki x Usui. COMPLETED.
Maid Sama! - Rated: T - English - Tragedy/Romance - Chapters: 2 - Words: 6,302 - Reviews: 43 - Favs: 52 - Follows: 11 - Updated: 11/10/2010 - Published: 7/1/2010 - Misaki A., T. Usui - Complete
Family by Wraith Ink-Slinger reviews
What if Reid wasn't an only child? How would things have been though the series if Reid had siblings? JJ/Reid tossed in there as well, as long as I'm messing with the canon.
Criminal Minds - Rated: T - English - Family - Chapters: 40 - Words: 74,230 - Reviews: 555 - Favs: 346 - Follows: 132 - Updated: 11/1/2010 - Published: 7/24/2010 - S. Reid - Complete
Salt Over Your Shoulder by Emma CS Me reviews
So Burt's sometimes a bit uncomfortable with his son's hobbies. So sometimes he overcompensates by eating a bit too much, and badly. And so what if he wants to hold onto that routine after his heart attack?
Glee - Rated: T - English - Angst/Family - Chapters: 1 - Words: 2,679 - Reviews: 14 - Favs: 25 - Follows: 6 - Published: 10/31/2010 - Burt H., Kurt H. - Complete
Internet Sensation by teamLNMM reviews
Beast Boy was caught in the act of something embarassing on video tape. What will happen when Robin, Starfire, and Cyborg show it to the entire viewing world and how will it affect Raven? What else could come out of this? BB/Rae and major Rob/Star.
Teen Titans - Rated: K+ - English - Humor/Romance - Chapters: 16 - Words: 26,064 - Reviews: 101 - Favs: 39 - Follows: 22 - Updated: 10/30/2010 - Published: 11/29/2009 - Beast Boy, Robin - Complete
Little Dancer by absurdvampmuse reviews
Camille/Moose one piece. His attention was diverted back to Camille as she came rushing back out of the dorm. She held her head low and was keeping her arms close to her body, so different from how she held herself when she was around him.
Step Up - Rated: K+ - English - Drama/Romance - Chapters: 1 - Words: 4,160 - Reviews: 28 - Favs: 81 - Follows: 13 - Published: 10/30/2010 - Complete
I Can Make You a Man by Psychedelic-City reviews
"You're gonna poke me with a WHAT?" Kurt helps Sam rehearse for WMHS's production of The Rocky Horror Picture Show. Spoilers for RHGS.
Glee - Rated: T - English - Romance/Humor - Chapters: 8 - Words: 8,413 - Reviews: 224 - Favs: 280 - Follows: 164 - Updated: 10/25/2010 - Published: 10/14/2010 - Kurt H., Sam E. - Complete
I Won't Dance Without You by dance-of-the-butterflies reviews
A series of oneshots about Moose and Camille, the cutest couple in Step Up 3. Enjoy and review please :D
Step Up - Rated: K - English - Romance/Friendship - Chapters: 8 - Words: 15,483 - Reviews: 77 - Favs: 77 - Follows: 46 - Updated: 10/24/2010 - Published: 8/27/2010
Negation by Emma CS Me reviews
Now his stomach hurts. He thinks he's going to be sick. Because sure he didn't say no to Kurt, but he didn't say no when he was like seven to his mom's boyfriend either.
Glee - Rated: T - English - Angst/Drama - Chapters: 1 - Words: 5,383 - Reviews: 12 - Favs: 70 - Follows: 4 - Published: 10/17/2010 - Finn H., Kurt H. - Complete
Like It Always Did And Will Always Will by Sweettweet07 reviews
FINAL CHAPTER ADDED! Youpiii, thanks for all the ones who wrote a review:I love you: : Misaki is invited to a prestigious party. Will she meet someone? And what if Usui was about to lose her? How would he reacts? Find out by reading it !
Maid Sama! - Rated: K+ - English - Drama/Romance - Chapters: 4 - Words: 6,899 - Reviews: 29 - Favs: 41 - Follows: 12 - Updated: 10/9/2010 - Published: 10/2/2010 - T. Usui, Misaki A. - Complete
I'm Sorry by Ykari reviews
Kurt remembers the doctor appearing around the corner minutes later with apologies that destroyed his entire world. Alternate ending to "Grilled Cheesus" in which Burt Hummel doesn't pull through.
Glee - Rated: T - English - Angst/Tragedy - Chapters: 1 - Words: 801 - Reviews: 16 - Favs: 68 - Follows: 10 - Published: 10/8/2010 - Kurt H. - Complete
Papa, What Do You Hear? by Emma CS Me reviews
Five times someone realized Burt and Kurt were a bit too close for comfort, but did nothing; and the one time someone finally reacted.
Glee - Rated: T - English - Drama - Chapters: 1 - Words: 4,846 - Reviews: 9 - Favs: 45 - Follows: 5 - Published: 10/8/2010 - Kurt H., Burt H. - Complete
Documentation by Emma CS Me reviews
The Glee club and the Hummel-Hudson household write down the fallout, and look for the causes of an attempted suicide. Finn's.
Glee - Rated: T - English - Angst/Friendship - Chapters: 4 - Words: 6,159 - Reviews: 22 - Favs: 44 - Follows: 54 - Updated: 9/29/2010 - Published: 7/16/2010 - Finn H.
Imust see a therapist by little Princess unicorn reviews
When a therapist goes to sams school and wants to see her what will she spill? SEDDIE! Note: The last chapter that i wrote was NOT THE LAST I REPETE NOT THE LAST! I WOULDNT JUST LEAVE IT LIKE THAT! Next chapter coming soon!
iCarly - Rated: T - English - Romance/Drama - Chapters: 14 - Words: 8,233 - Reviews: 71 - Favs: 12 - Follows: 15 - Updated: 9/28/2010 - Published: 7/20/2009 - Sam P., Freddie B.
Spencer's Secret by MissdaVinci77 reviews
Morgan has his suspicions about the young Doctor's love life. Does Spencer have a secret he isn't sharing with the team? Oneshot
Criminal Minds - Rated: T - English - Humor/Friendship - Chapters: 1 - Words: 1,606 - Reviews: 23 - Favs: 163 - Follows: 41 - Published: 9/27/2010 - S. Reid, D. Morgan - Complete
My Favorite Troll by Knut Case reviews
When Coraline's parents fly her old friend Robbie all the way from Michigan for her birthday, Wybie realises that he might lose her for good... It doesn't help that Beldam is back in the picture. CxW CxOC T for swearing. COMPLETE
Coraline - Rated: T - English - Romance/Friendship - Chapters: 17 - Words: 38,750 - Reviews: 165 - Favs: 84 - Follows: 38 - Updated: 9/27/2010 - Published: 4/13/2010 - Coraline J., Wybie L. - Complete
Reaching For Her Hand by flightlessraven reviews
A simple assignment turns lethal in a matter of seconds when an old "friend" returns for revenge on Raven. With Raven a centimeter away from death, Beast Boy realizes how much he really cares about the empath. The question us, is he too late? COMPLETE.
Teen Titans - Rated: T - English - Suspense/Romance - Chapters: 16 - Words: 21,522 - Reviews: 116 - Favs: 64 - Follows: 35 - Updated: 9/26/2010 - Published: 7/21/2010 - Beast Boy, Raven - Complete
The Quiet Scream by Evil Beware We Have Waffles reviews
He's there. Then he's not. Am I going insane? Is life torturing me? The only thing I know, is that I'm afraid to admit I might be crazy. Because if I'm crazy. They'll take him away. Agnsty Seddie. I do not own iCarly.
iCarly - Rated: T - English - Supernatural/Romance - Chapters: 23 - Words: 40,424 - Reviews: 325 - Favs: 90 - Follows: 47 - Updated: 9/26/2010 - Published: 3/21/2010 - Freddie B., Sam P. - Complete
Wedding Dress by TeenageCrisis reviews
She looked so lovely in her wedding dress. If only it was for him. *can go with any pairing you can think of*
Misc. Anime/Manga - Rated: K+ - English - Romance/Hurt/Comfort - Chapters: 1 - Words: 509 - Reviews: 3 - Favs: 1 - Published: 9/26/2010
My Hero by GlassCase reviews
What was a police officer doing here at midnight? "What's his job anyway? To ogle at girls all night in a mall?" Misaki thought to herself. One-Shot AU
Maid Sama! - Rated: T - English - Romance/Drama - Chapters: 1 - Words: 5,595 - Reviews: 17 - Favs: 62 - Follows: 13 - Published: 9/24/2010 - Misaki A., T. Usui - Complete
See, I'm Smiling by indefenseof reviews
Filling a prompt from glee angst meme: One of the mechanics at Burt's shop has been molesting Kurt for months. Shortly after meeting Finn, he goes after him too. This is mostly about the fallout.
Glee - Rated: M - English - Hurt/Comfort/Angst - Chapters: 12 - Words: 25,413 - Reviews: 86 - Favs: 226 - Follows: 117 - Updated: 9/22/2010 - Published: 8/18/2010 - Kurt H. - Complete
Subversion by Emma CS Me reviews
Finn is attacked by Kurt's boyfriend one night, when home alone. Not that anyone is going to realize it. Beware - triggery. COMPLETE.
Glee - Rated: M - English - Angst/Drama - Chapters: 10 - Words: 17,918 - Reviews: 53 - Favs: 71 - Follows: 30 - Updated: 9/21/2010 - Published: 6/29/2010 - Finn H. - Complete
iSee a Therapist by RabbittyBabbitty reviews
Freddie's mom sends him to a therapist because he's been acting "angsty". By not wanting to take tick baths, or even put on cloud block! His therapist doesn't think so, but since she's his therapist, she knows everything about him now. SEDDIE multichaper
iCarly - Rated: T - English - Romance/Humor - Chapters: 14 - Words: 18,640 - Reviews: 494 - Favs: 228 - Follows: 124 - Updated: 9/18/2010 - Published: 4/11/2010 - Freddie B., Sam P. - Complete
Spencer Reid: Guide and Owner's Manual by Mischief11 reviews
Tired of tripping over books? Want to know why he disappeares every night and come back strange? Read this handy manual and have some of your questions answered!
Criminal Minds - Rated: T - English - Humor/Parody - Chapters: 1 - Words: 1,027 - Reviews: 28 - Favs: 64 - Follows: 3 - Published: 9/12/2010 - S. Reid - Complete
The Right by Scarlet Letters reviews
A normal school assembly takes a turn for the worst when a few pictures bring up bad memories. Oneshot. WARNING: Possible triggers.
Glee - Rated: T - English - Angst/Drama - Chapters: 1 - Words: 2,547 - Reviews: 39 - Favs: 220 - Follows: 31 - Published: 9/9/2010 - Kurt H. - Complete
Fallacies of Normalcy by Sandylee007 reviews
While trying to recover from a yet another rough night, Reid wonders just how much more of this he'll be able to take. VERY mild slash maleOCxReid mentions of abuse A POTENTIAL FIVESHOT
Criminal Minds - Rated: T - English - Angst - Chapters: 5 - Words: 18,279 - Reviews: 98 - Favs: 153 - Follows: 59 - Updated: 9/8/2010 - Published: 8/18/2010 - S. Reid, D. Morgan - Complete
The Most Perfect Snow Day Ever by CMK Jam-Sam reviews
It wasn't every day that it snowed in Jump City; when it did, Gar wanted to make each day the most perfect snow day ever, even better then the last. But something was always missing... AU BBRae slight RobStar CyBee.
Teen Titans - Rated: K+ - English - Friendship/Romance - Chapters: 1 - Words: 6,183 - Reviews: 7 - Favs: 19 - Follows: 3 - Published: 9/7/2010 - Beast Boy, Raven
iFind Out The Truth About My Dad by abracadabra94 reviews
Freddie finds out why Sam has hated him all these years, and it might just lead them to go on an incredible journey together. Seddie. T, but probably nothing worse than some mild swearing.
iCarly - Rated: T - English - Adventure/Romance - Chapters: 18 - Words: 35,221 - Reviews: 146 - Favs: 75 - Follows: 45 - Updated: 9/4/2010 - Published: 7/21/2010 - Freddie B., Sam P. - Complete
Ten Years by BadWolfOfCamelot reviews
It's been ten years since the crash of Puckett and Benson. Seddie
iCarly - Rated: K+ - English - Angst/Friendship - Chapters: 1 - Words: 1,085 - Reviews: 5 - Favs: 11 - Follows: 1 - Published: 9/2/2010 - Freddie B., Sam P. - Complete
Noodles by The Hidden Girl reviews
"If you watch it, the water won't boil." a voice said from behind her. Raven turned to see Beast Boy. She went back to staring at the pot. "Staring doesn't matter. The water will boil either way." she said. [Oneshot]
Teen Titans - Rated: K - English - Humor/Friendship - Chapters: 1 - Words: 877 - Reviews: 40 - Favs: 116 - Follows: 13 - Published: 9/1/2010 - Beast Boy, Raven - Complete
Green Eggs and Ham: A Tragic Story by JamesTheGreater reviews
Sam has a new snack that she wants Freddie to try. Will she be able to convince him? Inspired by Green Eggs and Ham by Dr. Seuss.
iCarly - Rated: K+ - English - Poetry/Humor - Chapters: 1 - Words: 1,338 - Reviews: 25 - Favs: 19 - Published: 8/29/2010 - Freddie B., Sam P. - Complete
Shock by Magma Writes reviews
Raven asked Beast Boy a simple question that for some reason he wouldn't answer. What happens when she gets that answer…in the shower? The Titans don't know what's more shocking…Beast Boys plan…or that Raven agreed. BBRae
Teen Titans - Rated: K+ - English - Romance/Friendship - Chapters: 1 - Words: 2,208 - Reviews: 55 - Favs: 187 - Follows: 22 - Published: 8/28/2010 - [Beast Boy, Raven] - Complete
iBet by abracadabra94 reviews
Sam and Freddie make a friendly little wager that might lead to something they didn't expect. But they aren't the only ones who've been making bets. SEDDIE. One-shot. WARNING: EXTREME LEVELS OF CORNINESS AND FLUFF.
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 1,631 - Reviews: 50 - Favs: 91 - Follows: 6 - Published: 8/27/2010 - Freddie B., Sam P. - Complete
Where Were the Angels? by Stumblefoot reviews
Three weeks after "The End." Raven realizes something was missing. Beast Boy and Raven. Reviews very welcome, thank you. Not sure about the genres. T rating for mild swearing. Complete.
Teen Titans - Rated: T - English - Supernatural/Hurt/Comfort - Chapters: 3 - Words: 3,859 - Reviews: 17 - Favs: 40 - Follows: 10 - Updated: 8/26/2010 - Published: 8/14/2010 - Raven, Beast Boy - Complete
Scent by Magma Writes reviews
Beast Boy notices his wife Ravens scent smells as though it was mingled with another. The last and first time she smelled like that was when they finally became one. So what does this new scent mean? BBRae
Teen Titans - Rated: T - English - Romance/Drama - Chapters: 1 - Words: 3,480 - Reviews: 68 - Favs: 287 - Follows: 44 - Published: 8/22/2010 - [Beast Boy, Raven] - Complete
In The Event of Her Death by CurrentlyIncognito reviews
It was an accident that never should have happened. It was an event that was entirely preventable had the proper procedures had been taken. It never should have happened. This is tragedy in an otherwise wonderful love story. One-shot. Misaki/Usui.
Maid Sama! - Rated: T - English - Romance/Tragedy - Chapters: 1 - Words: 1,209 - Reviews: 41 - Favs: 61 - Follows: 8 - Published: 8/19/2010 - Misaki A., T. Usui - Complete
Her Fault by Morivanim reviews
It was all Penelope's fault.
Criminal Minds - Rated: K - English - Romance/Friendship - Chapters: 1 - Words: 528 - Reviews: 6 - Favs: 15 - Follows: 1 - Published: 8/16/2010 - P. Garcia, S. Reid - Complete
Change by Magma Writes reviews
Raven asks Beast Boy "If there was any one thing that you would change about me…what would it be?" and the answer may not be what she was expecting. Would his answer be as satisfactory as Robins answer to Starfire was? BBRae some RobStar
Teen Titans - Rated: K+ - English - Romance - Chapters: 1 - Words: 2,738 - Reviews: 83 - Favs: 296 - Follows: 39 - Published: 8/15/2010 - [Beast Boy, Raven] - Complete
Pain by Raven of Alaska reviews
We all have our pains. Pains from our past, pain from out battles. We may be Titans, but even we can feel pain. Mine almost kills me...
Teen Titans - Rated: T - English - Chapters: 1 - Words: 1,311 - Reviews: 8 - Favs: 19 - Follows: 6 - Published: 8/14/2010 - Beast Boy - Complete
Unrequited Love by cinderstellabella reviews
Sometimes you discover that the person you love loves you back. A series of one-shots. Moose/Camille
Step Up - Rated: T - English - Romance/Drama - Chapters: 3 - Words: 4,134 - Reviews: 39 - Favs: 52 - Follows: 15 - Updated: 8/12/2010 - Published: 8/11/2010 - Complete
Don't Know Much About History by TheSecretCity reviews
For the July TV prompt challenge. Reid decides to use his physics magic to get back at Strauss. Rated for language.
Criminal Minds - Rated: T - English - Humor/Family - Chapters: 7 - Words: 5,310 - Reviews: 122 - Favs: 215 - Follows: 76 - Updated: 8/12/2010 - Published: 7/23/2010 - S. Reid, D. Morgan - Complete
Second Chances by Kate-Emma reviews
Complete - Step Up 3D - Spoilers if you haven't seen it - She thought she'd lost her best friend for good, but like many other times before, she was so very wrong - Moose/Camille
Step Up - Rated: K - English - Romance/Friendship - Chapters: 1 - Words: 2,452 - Reviews: 12 - Favs: 65 - Follows: 12 - Published: 8/12/2010 - Camille G., Moose A. - Complete
Gublerland by SSAFunbar reviews
Garcia sends Morgan an e-mail with a link to MGG's website.
Criminal Minds - Rated: K - English - Humor - Chapters: 1 - Words: 498 - Reviews: 12 - Favs: 38 - Follows: 7 - Published: 8/10/2010 - S. Reid, D. Morgan - Complete
iConfess by Ms.Jellybean046 reviews
After Sam confesses a secret to Carly, Carly decides to do another Win A Date on iCarly with Freddie as the mystery date. Will Sam win, or some one else? Will Sam confess either way? Seddie.
iCarly - Rated: T - English - Humor/Romance - Chapters: 17 - Words: 24,235 - Reviews: 144 - Favs: 51 - Follows: 63 - Updated: 8/10/2010 - Published: 8/24/2009 - Freddie B., Sam P.
The Longest Night by Sandylee007 reviews
After all they've been through it's hard to imagine that they could lose one of them in a simple accident, because of a drunk driver. So why is Morgan fighting tonight to keep half dead, barely conscious Reid alive in a wreck of a car? TWOSHOT
Criminal Minds - Rated: T - English - Drama/Tragedy - Chapters: 2 - Words: 10,213 - Reviews: 177 - Favs: 347 - Follows: 56 - Updated: 8/9/2010 - Published: 8/1/2010 - S. Reid, D. Morgan - Complete
Just A Dance by they'recomingtotakemeaway reviews
Prentiss can't understand why Reid isn't jealous when Morgan dances with women. Reid attempts to show her why, with interesting consequences. ONESHOT.
Criminal Minds - Rated: K+ - English - Romance - Chapters: 1 - Words: 1,142 - Reviews: 9 - Favs: 60 - Follows: 15 - Published: 8/9/2010 - E. Prentiss, S. Reid - Complete
Sam's Cousin by doubletime twins reviews
sam's cousin, leah, comes for a visit,while she's here she reveals sam's biggest secret to everyone,but then carly sam and leah find freddie's secret and are now trying to reveal it seddie please excuse the mistakes in the beginning please : ....enjoy :/
iCarly - Rated: K+ - English - Humor/Romance - Chapters: 53 - Words: 49,510 - Reviews: 126 - Favs: 30 - Follows: 20 - Updated: 8/9/2010 - Published: 10/29/2008 - Freddie B., Sam P.
Poor Spencer by Ms.Stery reviews
"You know how sometimes, in life, there's just this one thing you can't seem to get away from. For Spencer Reid, it was a phrase. A short, simple phrase that seemed to follow him wherever he went." My very random oneshot. Not sure what genre. Read&Review?
Criminal Minds - Rated: K - English - Chapters: 1 - Words: 1,240 - Reviews: 7 - Favs: 10 - Published: 8/8/2010 - S. Reid
You know your obsessed with Criminal Minds if by MrsShemarMoore reviews
Just a little funny spoof. Lets see how many you agree with. Now thirty of them! I'll keep adding if you keep reviewing!
Criminal Minds - Rated: K+ - English - Humor - Chapters: 4 - Words: 1,733 - Reviews: 80 - Favs: 42 - Follows: 26 - Updated: 8/8/2010 - Published: 8/31/2009
Bubbles by Treskttn reviews
Raven has never blown a bubble. So what happens when she sees Beast Boy outside blowing bubbles? FLUFF, THAT'S WHAT! I'm terrible at summaries. Read and review please. ONESHOT
Teen Titans - Rated: K+ - English - Romance/Friendship - Chapters: 1 - Words: 960 - Reviews: 13 - Favs: 34 - Follows: 5 - Published: 8/8/2010 - Raven, Beast Boy - Complete
The Dos and Don'ts of Sexual Misconduct by REIDFANATIC reviews
One Shot: The team goes to a sexual conduct seminar and learn more than they wanted about themselves
Criminal Minds - Rated: T - English - Humor/Friendship - Chapters: 1 - Words: 883 - Reviews: 39 - Favs: 166 - Follows: 27 - Published: 8/6/2010 - S. Reid, P. Garcia - Complete
Love To Surprise by klcm reviews
Garcia's about to issue Morgan with the biggest surprise of his life... and hers.
Criminal Minds - Rated: K+ - English - Drama/Family - Chapters: 15 - Words: 35,227 - Reviews: 182 - Favs: 97 - Follows: 42 - Updated: 8/6/2010 - Published: 7/18/2010 - P. Garcia, D. Morgan - Complete
Kidnapped! The Musical by tfm reviews
Their own bizarre kidnapping and unexplained singing is definitely something the BAU could do without. But then again, there may be some positive side effects after all. JJ/Morgan. Hotch/Garcia. Rossi/Prentiss. Reid/Jordan. Kevin/Will.
Criminal Minds - Rated: T - English - Romance/Humor - Chapters: 12 - Words: 12,543 - Reviews: 65 - Favs: 25 - Follows: 21 - Updated: 8/6/2010 - Published: 1/23/2009 - Complete
studying by titansfan1211 reviews
cyborg catches beastboy with robin in the boy wonders room, but doing what? NOT SLASH.
Teen Titans - Rated: K+ - English - Humor - Chapters: 1 - Words: 1,387 - Reviews: 20 - Favs: 70 - Follows: 5 - Published: 8/4/2010 - Robin, Beast Boy - Complete
Kidnapped Again! by mabelreid reviews
Yes... Once again our genius is kidnapped. Reid wakes up in a lonly warehouse with no memory of how he got there. What he finds with him is totally unexpected.
Criminal Minds - Rated: K+ - English - Humor/Parody - Chapters: 3 - Words: 5,047 - Reviews: 49 - Favs: 40 - Follows: 20 - Updated: 8/3/2010 - Published: 7/30/2010 - S. Reid - Complete
Worst Case Scenario by Chloe Winchester reviews
Something horrible has happened to Hotch, he just has no idea what it is. With the team just as baffled and trying to find a missing Reid, it becomes a nightmare they all feared, an unsub targeting them. Hurt!Hotch Hurt!Reid NO SLASH! M for sexual abuse
Criminal Minds - Rated: M - English - Hurt/Comfort/Mystery - Chapters: 11 - Words: 14,601 - Reviews: 231 - Favs: 220 - Follows: 135 - Updated: 8/2/2010 - Published: 6/4/2010 - A. Hotchner/Hotch, S. Reid - Complete
In The Shadows Of The Trees by kk911 reviews
Who new Beast Boy had a sister? And what will happen when she needs his help back home? T to be safe. Please R&R because it's my first story.
Teen Titans - Rated: T - English - Adventure/Drama - Chapters: 2 - Words: 3,562 - Reviews: 6 - Favs: 7 - Follows: 11 - Updated: 8/2/2010 - Published: 2/16/2010 - Beast Boy, Raven
Fear by Kdibs227 reviews
He had feared this man. He had also hated him with everything he had. His only other fear was what they would do when they found out.
Teen Titans - Rated: K - English - Hurt/Comfort/Family - Chapters: 1 - Words: 2,458 - Reviews: 5 - Favs: 54 - Follows: 7 - Published: 7/31/2010 - Beast Boy - Complete
Walls by Magma Writes reviews
Some people say that Raven keeps a wall up around her to keep people out. But maybe the walls not there to keep people out… but to see who cares enough to break them down. BbRae
Teen Titans - Rated: K+ - English - Romance/Friendship - Chapters: 1 - Words: 4,823 - Reviews: 47 - Favs: 198 - Follows: 22 - Published: 7/29/2010 - [Beast Boy, Raven] - Complete
Behind the Veil by Evil Beware We Have Waffles reviews
I've built a wall, not to block anyone out, but to see who loves me enough to climb over it. I do not own SWAC. CHANNY FIC.
Sonny with a Chance - Rated: T - English - Romance/Angst - Chapters: 20 - Words: 28,531 - Reviews: 374 - Favs: 116 - Follows: 68 - Updated: 7/29/2010 - Published: 3/2/2010 - Chad D. C., Sonny M. - Complete
What Would Sue Sylvester Do? by Quallianmaghouin reviews
During a hostage situation, Kurt asks himself: What Would Sue Sylvester Do? A slightly cracky answer to a glee angst meme prompt
Glee - Rated: K+ - English - Humor/Drama - Chapters: 1 - Words: 1,027 - Reviews: 113 - Favs: 713 - Follows: 80 - Published: 7/27/2010 - Kurt H. - Complete
Long Nights by LoveforPenandDerek reviews
Morgan and Garcia. They share a room during a case.
Criminal Minds - Rated: M - English - Romance/Friendship - Chapters: 7 - Words: 11,481 - Reviews: 121 - Favs: 152 - Follows: 38 - Updated: 7/27/2010 - Published: 7/22/2010 - D. Morgan, P. Garcia - Complete
Not a Victim by Crawler reviews
Kink meme fill: Puck is pretty sure a rape victim is supposed to be upset or angry or... or anything other than the indifference Kurt Hummel is showing. He'll do whatever it takes to make that boy feel again. Puck/Kurt, Kurt/OC non-con
Glee - Rated: M - English - Angst/Hurt/Comfort - Chapters: 1 - Words: 17,498 - Reviews: 63 - Favs: 433 - Follows: 65 - Published: 7/26/2010 - Kurt H., Puck - Complete
The Best Laid Plans by KricketWilliams reviews
Penelope is dating someone... and it throws Derek for a loop. As usual, I don't own a thing. M/G, with extended chapters for Reid.
Criminal Minds - Rated: M - English - Romance/Friendship - Chapters: 14 - Words: 15,698 - Reviews: 345 - Favs: 114 - Follows: 46 - Updated: 7/26/2010 - Published: 7/14/2010 - D. Morgan, P. Garcia - Complete
Stuck in the well by MazzyBooks reviews
*One shot* Coraline sneeks out of her house to search for Wybie, she soon finds him in the last place she thought she would.
Coraline - Rated: K - English - Friendship - Chapters: 1 - Words: 2,093 - Reviews: 8 - Favs: 18 - Follows: 2 - Published: 7/25/2010 - Coraline J., Wybie L. - Complete
iGo To The Hospital by OverkiII reviews
Sam starts the day off with a small stomachache and thinks nothing of it, blaming it on some beef jerky. When the symptoms start getting worse and she feels sick, she has to rely on Carly and Freddie to help her out, especially with her fear of hospitals!
iCarly - Rated: T - English - Friendship/Hurt/Comfort - Chapters: 109 - Words: 323,885 - Reviews: 1874 - Favs: 236 - Follows: 173 - Updated: 7/24/2010 - Published: 7/9/2009 - Sam P., Carly S.
Lying In His Angel's Arms by DramaticSheep reviews
Hermione comforts Ron after the battle of Hogwarts for his fallen brother, Fred. R/Hr. One Shot. Feedback is really appreciated, hope you like this.
Harry Potter - Rated: K - English - Hurt/Comfort/Tragedy - Chapters: 1 - Words: 891 - Reviews: 12 - Favs: 40 - Follows: 1 - Published: 7/22/2010 - Hermione G., Ron W. - Complete
Brave Sir Robin by B00k Freak reviews
Beast boy learns a new song, but it doen't amuse everyone. Humor. Rated for one word. I own nothing
Teen Titans - Rated: K+ - English - Humor - Chapters: 1 - Words: 699 - Reviews: 26 - Favs: 55 - Follows: 5 - Published: 7/20/2010 - Beast Boy, Robin - Complete
I'd Lie by AnNyanimous reviews
Songfic originally done by thenormalfreak. Raven has to prove that she knows Beast Boy to prove his innocence. Go read the original and review that one Doesn't hurt to review this one too though :D
Teen Titans - Rated: K+ - English - Romance - Chapters: 1 - Words: 1,201 - Reviews: 7 - Favs: 11 - Follows: 1 - Published: 7/19/2010 - Raven, Beast Boy - Complete
DECAF by lazywriter123 reviews
Spencer faces his greatest fear...DECAF! Very short, funny story.
Criminal Minds - Rated: K+ - English - Humor - Chapters: 1 - Words: 445 - Reviews: 21 - Favs: 45 - Follows: 3 - Published: 7/17/2010 - S. Reid - Complete
Chaos Theory by Chloe Winchester reviews
Spencer has been missing for 2 years, and when the BAU finds him, they find a broken and scared young man. And the worst of it, the man that took him is still out there. Some chapters rated M. Reidcentric NO SLASH set in season 2 Major Reid whumpage!
Criminal Minds - Rated: T - English - Hurt/Comfort/Angst - Chapters: 31 - Words: 48,662 - Reviews: 1304 - Favs: 996 - Follows: 455 - Updated: 7/16/2010 - Published: 12/28/2009 - S. Reid, D. Morgan - Complete
The Process of Falling In Love by blackogd reviews
Are you a BBxRA fan how about RAxST or maybe RAxBBxST? If you so then start reading this story. Keep tabs on this story or you'll miss out on a good story.
Teen Titans - Rated: M - English - Romance - Chapters: 7 - Words: 14,896 - Reviews: 26 - Favs: 25 - Follows: 20 - Updated: 7/14/2010 - Published: 2/20/2010 - Beast Boy, Raven
Talk To Me by annicaspoon reviews
Raven asks Beast Boy something that he never thought she would. BBRae oneshot with some RobStar flavouring. Rated T for a few little mentions.
Teen Titans - Rated: T - English - Romance/Friendship - Chapters: 1 - Words: 2,136 - Reviews: 32 - Favs: 96 - Follows: 12 - Published: 7/13/2010 - Beast Boy, Raven - Complete
The Renegade by xXNevermoreAgainXx reviews
Gar Logan expected to get a new pet. What he didn't expect was to find his best friend and be sent on the biggest adventure of his life. AU. Bad summery, actually a good story
Teen Titans - Rated: T - English - Adventure/Supernatural - Chapters: 3 - Words: 2,971 - Reviews: 25 - Favs: 6 - Follows: 10 - Updated: 7/12/2010 - Published: 12/19/2009 - Beast Boy, Raven
Shadows of the Past by xXNevermoreAgainXx reviews
A mysterious girl appears in Jump City. Beaten and broken, she asks to stay with the Titans until it is safe for her to return home. But who is this girl? And why do two of the Titans feel as though they would give anything to protect her?
Teen Titans - Rated: T - English - Adventure - Chapters: 13 - Words: 35,388 - Reviews: 92 - Favs: 40 - Follows: 29 - Updated: 7/12/2010 - Published: 6/18/2009 - Beast Boy, Raven
I Smile Because You Love Me by xXNevermoreAgainXx reviews
Beast Boy, why are you smiling at me like that?" A series of oneshots about everyone's favorite love-hate couple! BBxRae all the way!
Teen Titans - Rated: T - English - Romance - Chapters: 17 - Words: 8,061 - Reviews: 227 - Favs: 65 - Follows: 40 - Updated: 7/12/2010 - Published: 8/17/2009 - Beast Boy, Raven
iAm the Bachelor by JamesLily96 reviews
When, Freddie Benson becomes the next bachelor on a popular T.V. show, trouble will sure ensue when a certain Sam Puckett shows up to be one of the bachelorette's.
iCarly - Rated: T - English - Romance/Humor - Chapters: 24 - Words: 38,727 - Reviews: 318 - Favs: 159 - Follows: 102 - Updated: 7/10/2010 - Published: 1/5/2010 - Freddie B., Sam P. - Complete
The Stuffed Tiger by PsychoticAppleSauce reviews
When you look in Samantha Puckett's room, you'll see many things. But if you'll notice the stuffed tiger on the shelf, it has witnessed the life and death of Samantha Puckett. PLEASE READ. Oh and review,those are good too. My best one-shot so far.
iCarly - Rated: T - English - Angst - Chapters: 1 - Words: 918 - Reviews: 40 - Favs: 37 - Follows: 5 - Published: 7/7/2010 - Sam P. - Complete
Final Mission by Emerald and Amethyst Hero reviews
Beast Boy's past comes back to haunt him but not in the way he expected. He must now deal with old enemies, new aliances, and painful memories. Will he and Raven be able to overcome them all and find eachother? Or will they never see eachother again?
Teen Titans - Rated: T - English - Adventure/Romance - Chapters: 16 - Words: 37,411 - Reviews: 54 - Favs: 83 - Follows: 24 - Updated: 6/29/2010 - Published: 4/5/2010 - Beast Boy, Raven - Complete
Give it back by Camacartz reviews
Morgan tries to stop Reid from having his morning coffee
Criminal Minds - Rated: K - English - Humor - Chapters: 1 - Words: 499 - Reviews: 17 - Favs: 66 - Follows: 7 - Published: 6/28/2010 - S. Reid, D. Morgan - Complete
Wagering Love by Lady Azura reviews
Lizzie doesn't believe in love, but when Edwin bets her that he can make her fall for him by the end of the month, will she change her mind? On Hiatus.
Life With Derek - Rated: T - English - Romance/Humor - Chapters: 4 - Words: 8,258 - Reviews: 70 - Favs: 55 - Follows: 54 - Updated: 6/25/2010 - Published: 6/28/2009 - Edwin V., Lizzie M.
The Legend Of The Cat's Shadow by chrica reviews
Every 500 years, a girl is born to combat the most powerful demon ever. None made it past 14. So what happens when the next chosen girl happens to be Sam? All she know's is that she is not going down without a fight. Contains action, adventure and romance
Danny Phantom - Rated: K - English - Supernatural/Adventure - Chapters: 8 - Words: 7,547 - Reviews: 21 - Favs: 12 - Follows: 16 - Updated: 6/23/2010 - Published: 1/4/2010 - Sam M., Danny F.
iThink I'm Dreaming by Mixwe reviews
For a science project Freddie montitors Sam while she's sleeping, what seddie-filled stuff will come up? hehehe, I've gots lots of Seddieness for you people! Read Read!
iCarly - Rated: T - English - Humor/Romance - Chapters: 10 - Words: 12,712 - Reviews: 137 - Favs: 77 - Follows: 45 - Updated: 6/22/2010 - Published: 4/30/2010 - Freddie B., Sam P. - Complete
Healing by omalleyanatomy26 reviews
A one shot where Morgan walks in on Reid in the bathroom about to take the drugs. Furious Morgan demans to know what's going on and Reid breaks down in front of him. PLEASE PLEASE REVIEW!
Criminal Minds - Rated: K - English - Chapters: 1 - Words: 1,015 - Reviews: 18 - Favs: 55 - Follows: 14 - Published: 6/20/2010 - Complete
iDon't Hate You by grumpyjenn reviews
Seddie one-shot. T for safety. What happens when yet another boy prefers Carly to Sam?
iCarly - Rated: T - English - Friendship/Romance - Chapters: 1 - Words: 1,207 - Reviews: 4 - Favs: 16 - Follows: 2 - Published: 6/20/2010 - Freddie B., Sam P. - Complete
Glasses by ruthc93 reviews
Why exactly did Sam continue to wear the glasses? One-shot. Short. FLAM.
Cloudy with a Chance of Meatballs - Rated: K - English - Romance/Friendship - Chapters: 1 - Words: 453 - Reviews: 16 - Favs: 40 - Follows: 4 - Published: 6/18/2010 - Complete
CBS done WHAT! by apracot reviews
What the team think of two of the characters on their favourite TV show being cut... sound familiar? This is dedicated to AJ and Paget! T for language
Criminal Minds - Rated: T - English - Hurt/Comfort/Friendship - Chapters: 1 - Words: 1,074 - Reviews: 24 - Favs: 24 - Follows: 3 - Published: 6/17/2010 - E. Prentiss, Jennifer J./JJ - Complete
Lessons Learned the Hard Way by MissdaVinci77 reviews
The BAU is threatened by a dangerous unSub holding one of their own hostage. What would each of them do to make sure their team member makes it home alive? Will they find him and how will Reid cope? Reid whumpage. I do not own Criminal Minds. Duh
Criminal Minds - Rated: T - English - Drama/Angst - Chapters: 26 - Words: 29,716 - Reviews: 401 - Favs: 322 - Follows: 130 - Updated: 6/15/2010 - Published: 5/21/2010 - S. Reid - Complete
Tickle by Meyberry reviews
Beast Boy finally finds a way to make Raven laugh. BBRAE.
Teen Titans - Rated: K+ - English - Romance/Friendship - Chapters: 1 - Words: 969 - Reviews: 30 - Favs: 115 - Follows: 13 - Published: 6/15/2010 - Raven, Beast Boy - Complete
iT Was All Worth It by Rhiabrey Skye reviews
17 year old Freddie experiences holding his baby's tiny hand for the first time. He's not dissapointed about the earlier fights, tears, cursing, and heartbreaks, because in the end, it was all worth it. Teenage pregnacy isn't always a bad thing. SEDDIE
iCarly - Rated: T - English - Romance/Hurt/Comfort - Chapters: 1 - Words: 6,005 - Reviews: 48 - Favs: 73 - Follows: 13 - Updated: 6/15/2010 - Published: 11/25/2009 - Sam P., Freddie B. - Complete
Swear to Shake it Up if You Swear to Listen by TheFolliesofYouth reviews
The annual FBI masquerade ball. An unwilling genius. A plan to rock everyone's socks off. The story of how Spencer Reid actually enjoyed himself at a party.
Criminal Minds - Rated: K - English - Humor/Friendship - Chapters: 1 - Words: 2,819 - Reviews: 28 - Favs: 162 - Follows: 19 - Published: 6/13/2010 - S. Reid - Complete
A Darkened Mind: Part One by Aquarius Princess reviews
Chap. 1-50. Every relationship has its problems, but will you get out before it is too late? Sam and Freddie are in an abusive situation that they both can't handle. What will triumph? List of warnings and pairings inside. *currently undergoing rewriting*
iCarly - Rated: T - English - Hurt/Comfort/Drama - Chapters: 51 - Words: 153,605 - Reviews: 400 - Favs: 95 - Follows: 39 - Updated: 6/11/2010 - Published: 7/4/2009 - Freddie B., Sam P. - Complete
Simon Says by purplerayz reviews
You have a decision to make. Every hour that is. Either I kill someone, or I hurt him in whichever way I choose. - An unsub forces the team to make a hard decision.
Criminal Minds - Rated: T - English - Drama/Angst - Chapters: 16 - Words: 17,016 - Reviews: 348 - Favs: 374 - Follows: 138 - Updated: 6/6/2010 - Published: 5/20/2010 - S. Reid - Complete
Out of Reach by PancakeMassacre reviews
Reid is kidnapped… again. Can the team find him in time? WARNING: has more than earned its M rating. No pairings but lots of whump
Criminal Minds - Rated: M - English - Hurt/Comfort/Suspense - Chapters: 14 - Words: 42,733 - Reviews: 295 - Favs: 518 - Follows: 218 - Updated: 6/2/2010 - Published: 1/18/2010 - S. Reid - Complete
Secrets by AKosh reviews
Beast Boy has a secret. But who can he tell?
Teen Titans - Rated: K+ - English - Humor/Romance - Chapters: 1 - Words: 547 - Reviews: 10 - Favs: 41 - Follows: 6 - Published: 6/1/2010 - Beast Boy, Raven - Complete
Repeating History by Megan Potassium reviews
The football team couldn't win a game until a designer-wearing-countertenor pranced onto the scene. Same goes for the baseball team. Rated T for language. Various POV. Not intended to be slash.
Glee - Rated: T - English - Friendship/Angst - Chapters: 4 - Words: 8,032 - Reviews: 52 - Favs: 62 - Follows: 123 - Updated: 5/27/2010 - Published: 3/2/2010 - Kurt H.
The Quiet Ones by Wraith Ink-Slinger reviews
Anyone watching Reid in an interrogation room knows it's the quiet ones you have to watch out for. Oneshot.
Criminal Minds - Rated: T - English - Drama - Chapters: 1 - Words: 2,106 - Reviews: 88 - Favs: 1,013 - Follows: 173 - Published: 5/26/2010 - S. Reid - Complete
Daddy's Girl by JunoLuv reviews
Sam's dad is back after ten years, but he only complicates things more for his daughter. WARNING: This story contains some graphic chizz. Why do you think it's rated M?
iCarly - Rated: M - English - Angst/Drama - Chapters: 45 - Words: 109,284 - Reviews: 332 - Favs: 145 - Follows: 53 - Updated: 5/25/2010 - Published: 10/23/2009 - Sam P., Freddie B. - Complete
The Not So Secret Life of Dr Spencer Reid by MissdaVinci77 reviews
Morgan realizes that he does not know anything personal about his collegue. So what does he do? Snoop. What does he find? Not what he expected. I do not own Criminal Minds, although I like to pretend I do
Criminal Minds - Rated: K+ - English - Friendship - Chapters: 1 - Words: 1,255 - Reviews: 36 - Favs: 202 - Follows: 44 - Published: 5/23/2010 - S. Reid, D. Morgan - Complete
Lessons In Driving by Wraith Ink-Slinger reviews
It turns out Reid is good in a car chase, and Morgan wonders where he acquired that skill. Oneshot.
Criminal Minds - Rated: T - English - Humor - Chapters: 1 - Words: 1,766 - Reviews: 64 - Favs: 762 - Follows: 132 - Published: 5/22/2010 - S. Reid, D. Morgan - Complete
Love me you fool' by Aitouketsu reviews
Beast Boy, left alone by his team responds to an emergency and meets a crew of people who have Dangerous written all over them RaexBB. For now Rated M for future chapters. Coupling may change for a few characters. Some OOC, and new made chars.
Teen Titans - Rated: M - English - Romance/Drama - Chapters: 4 - Words: 3,891 - Reviews: 30 - Favs: 15 - Follows: 24 - Updated: 5/12/2010 - Published: 4/24/2008 - Beast Boy, Raven
Immobilized by Evil Beware We Have Waffles reviews
Freddie Benson had not seen this coming. He had always been taught to look both ways before crossing the street, and he always had. But had he grown so careless? Why didn't he look? He was stupid, he didn't look, he didn't check twice. He forgot.
iCarly - Rated: T - English - Romance/Angst - Chapters: 21 - Words: 28,500 - Reviews: 195 - Favs: 56 - Follows: 52 - Updated: 5/8/2010 - Published: 1/17/2010 - Freddie B., Sam P. - Complete
Challenge of the Changeling by TheMightyErrg reviews
As a hero Changeling has had to face many challenges and tribulations, however, the latest might be a bite too much even for him.
Teen Titans - Rated: T - English - Humor - Chapters: 1 - Words: 1,504 - Reviews: 9 - Favs: 17 - Follows: 4 - Published: 5/5/2010 - Beast Boy, Raven - Complete
iWent to Far by PsychoticAppleSauce reviews
Freddie is sick of all the pranks that Sam plays on him and wants to get even. What happens when the prank backfires? Hello Pay back. Seddiekinz.
iCarly - Rated: T - English - Hurt/Comfort/Friendship - Chapters: 3 - Words: 1,861 - Reviews: 15 - Favs: 15 - Follows: 9 - Updated: 5/3/2010 - Published: 4/16/2010 - Sam P., Freddie B. - Complete
Your Mom by JeSuisClandestine reviews
Puck hits a nerve. *Drabble alert!*
Glee - Rated: K - English - Angst/Family - Chapters: 1 - Words: 246 - Reviews: 13 - Favs: 41 - Follows: 7 - Published: 5/2/2010 - Kurt H., Puck - Complete
Never Been This Far Away From Home by airekuh reviews
“If she thinks no one cares, then she really will never come back.” That was it, he sighed in relief, that was the reason why he had done this, because he couldn't even imagine life without her. He needed her to come back. Sam/Freddie. WIP.
iCarly - Rated: T - English - Romance/Angst - Chapters: 5 - Words: 9,718 - Reviews: 37 - Favs: 16 - Follows: 25 - Updated: 4/30/2010 - Published: 11/3/2009 - Freddie B., Sam P.
Pain and Fear, Hurt and Loss by TheFirstElf reviews
When Raven loses control of her Rage, a Titan gets hurt. Will he forgive her? A BBRae Oneshot. Rated T for a reason.
Teen Titans - Rated: T - English - Angst/Romance - Chapters: 1 - Words: 1,502 - Reviews: 3 - Favs: 70 - Follows: 18 - Published: 4/30/2010 - Beast Boy, Raven - Complete
Out of My League by Treskttn reviews
Raven and Beastboy have been going out for two weeks, but what happens when Beastboy is told she is too good for him? Oneshot!
Teen Titans - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 836 - Reviews: 12 - Favs: 38 - Follows: 8 - Published: 4/27/2010 - Beast Boy, Raven - Complete
Wet Dreams, Oh Beautiful Nightmare by Rhiabrey Skye reviews
At a point in his life, every teenage boy experiences a wet dream. It’s a simple, normal step into one’s life at becoming an adult. There’s nothing weird or embarrassing about it. That is, if it's not about a certain blonde. SEDDIE//ONE SHOT.Sequel NOW UP
iCarly - Rated: M - English - Romance/Humor - Chapters: 2 - Words: 4,716 - Reviews: 56 - Favs: 81 - Follows: 19 - Updated: 4/27/2010 - Published: 2/6/2010 - Freddie B., Sam P. - Complete
Wrongful Accusations by OtisSpofford reviews
After an important mission goes sour,Kim explodes at Ron and tells him she doesn't need him anymore.When she goes to apologize she discovers he's w she must find him and attempt to save their relationship. Updates are primarily grammatical in nature.
Kim Possible - Rated: T - English - Drama/Romance - Chapters: 1 - Words: 3,019 - Reviews: 14 - Favs: 48 - Follows: 10 - Published: 4/24/2010 - Kim P., Ron S. - Complete
Sonny Munroe's First Aid Kit by Sugar Rush4eva reviews
-"ow." "Stop moving so much." "OW!"
Sonny with a Chance - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 744 - Reviews: 28 - Favs: 43 - Follows: 3 - Published: 4/24/2010 - Chad D. C., Sonny M. - Complete
My Bad Days Are Worse Than Yours by Chaos Dragon reviews
Some people have bad days, but I swear mine put them all to shame.
Danny Phantom - Rated: T - English - Romance - Chapters: 1 - Words: 2,378 - Reviews: 28 - Favs: 171 - Follows: 24 - Published: 4/23/2010 - [Sam M., Danny F.] - Complete
Sam's List of Guys Better Than Edward Cullen by Gabsikle reviews
Sam's not really a fan of Edward Cullen. So she makes a list of guys who are better than him for Carly to read. She's a little embarrassed of her number one. What happens when she loses it, and Freddie reads it? *Seddie*
iCarly - Rated: T - English - Humor/Romance - Chapters: 12 - Words: 17,652 - Reviews: 587 - Favs: 409 - Follows: 150 - Updated: 4/21/2010 - Published: 3/20/2010 - Freddie B., Sam P. - Complete
iWanna Die For You by Tarafina reviews
She laughs, blood spatters across her lips…
iCarly - Rated: T - English - Angst/Tragedy - Chapters: 1 - Words: 775 - Reviews: 8 - Favs: 19 - Follows: 2 - Published: 4/21/2010 - Freddie B., Sam P. - Complete
CPR: Crazy Perverted Retard by RaVeN.RoTh16 reviews
Examine the title. You do know what CPR is right? Then it's pretty self explanatory. BBXRAE, of course.
Teen Titans - Rated: K+ - English - Humor - Chapters: 1 - Words: 760 - Reviews: 9 - Favs: 19 - Follows: 1 - Published: 4/20/2010 - Beast Boy, Raven - Complete
Animated by lazywriter123 reviews
Today is going to be a little weird at the BAU office.
Criminal Minds - Rated: T - English - Humor - Chapters: 1 - Words: 536 - Reviews: 10 - Favs: 14 - Published: 4/16/2010 - Complete
iMark My Territory by Tarafina reviews
Sam was just putting her stamp on what was hers; nothing wrong with that.
iCarly - Rated: K+ - English - Humor/Romance - Chapters: 1 - Words: 2,538 - Reviews: 31 - Favs: 92 - Follows: 11 - Published: 4/15/2010 - Freddie B., Sam P. - Complete
For Better Or For Worse by RavenFollower13 reviews
Sequel to Unwanted Guest One year has passed and the Titans remember no trace of Ella. But when a mystery figure keeps showing up everywhere and this 'Master' gets a new deadly apprentice, Raven discovers what can save them all. But is it too late?
Teen Titans - Rated: T - English - Romance/Drama - Chapters: 23 - Words: 81,699 - Reviews: 62 - Favs: 39 - Follows: 21 - Updated: 4/14/2010 - Published: 5/17/2009 - Beast Boy, Raven - Complete
Favourite Colours by ShadowManipulator7 reviews
Who knew Raven's favourite colour used to be green? '-.-'
Teen Titans - Rated: K+ - English - Romance - Chapters: 1 - Words: 1,314 - Reviews: 12 - Favs: 45 - Follows: 6 - Published: 4/12/2010 - Beast Boy, Raven - Complete
iJoin The Front Lines by PsychoticAppleSauce reviews
When twenty-four year old Sam joins the Army, she is one of 15 special soldiers sent to the front lines. What happens when she is teamed up with an old friend? *Seddie* T- for violence
iCarly - Rated: T - English - Adventure/Friendship - Chapters: 5 - Words: 5,445 - Reviews: 21 - Favs: 26 - Follows: 8 - Updated: 4/11/2010 - Published: 4/7/2010 - Sam P., Freddie B. - Complete
Guilty of Spinning by muchasfandomas reviews
Freddie and Sam are both aware that their relationship is changing... but what happens when they both like a little game of Spin the Bottle a little too much? Sequel to Messages in Liquor Bottles.
iCarly - Rated: T - English - Romance/Humor - Chapters: 7 - Words: 5,501 - Reviews: 20 - Favs: 21 - Follows: 18 - Updated: 4/10/2010 - Published: 3/27/2010 - Sam P., Freddie B. - Complete
Uncle Spencer by SayidRocks reviews
Spencer Reid babysits his godson Henry overnight, while Henry's parents JJ and Will attend a family event. A few days later he faces humorous consequences at work when adorable photos of he and his godson make the rounds at the F.B.I.
Criminal Minds - Rated: K - English - Humor/Family - Chapters: 2 - Words: 5,604 - Reviews: 42 - Favs: 192 - Follows: 39 - Updated: 4/9/2010 - Published: 3/26/2010 - S. Reid, Henry L. - Complete
iDate Online by loonyluvgood reviews
When Carly starts an iCarly online dating service, Freddie wants nothing to do with it. That is, until he meets the love of his life. But when he goes to meet her, he gets a little more then he bargained for.
iCarly - Rated: K+ - English - Romance - Chapters: 6 - Words: 5,517 - Reviews: 41 - Favs: 20 - Follows: 28 - Updated: 4/9/2010 - Published: 10/7/2009 - Freddie B., Sam P.
iNeed It by NeoNails reviews
Carly always said that every girl had a little black dress. Sam thought she was full of it, but she never said anything. Until she saw it." Slight Seddie.
iCarly - Rated: T - English - Humor/Romance - Chapters: 1 - Words: 1,732 - Reviews: 14 - Favs: 49 - Follows: 7 - Published: 4/8/2010 - Sam P., Freddie B. - Complete
Beast boy and Raven play with dolls by XXThunderStormXX reviews
Beast boy and Raven play with dolls, and each other... I don't think anything else needs to be said. IMO it's not one of my better fics but I'd appreciate it if you read it and told me what you thought.
Teen Titans - Rated: M - English - Romance - Chapters: 1 - Words: 2,622 - Reviews: 26 - Favs: 65 - Follows: 12 - Published: 4/7/2010 - Beast Boy, Raven - Complete
That's My Name by AKosh reviews
Once the Titans learn each others birth names, what can Beast Boy do to stop being called Garfield? Really short one-shot. Got that idea from a scene from ABC's "Castle" Rated T for sexual implications.
Teen Titans - Rated: T - English - Humor/Romance - Chapters: 1 - Words: 851 - Reviews: 19 - Favs: 81 - Follows: 8 - Published: 4/7/2010 - Raven, Beast Boy - Complete
Jokes VS Insults by RaVeN.RoTh16 reviews
Beast Boy tells jokes. Raven insults him. That's the way the world works... right? So, how far does the Earth tilt when Beast Boy insults her back ten times worse? Enough to make her kiss him? What? Rated T for one teensy little curse word.
Teen Titans - Rated: T - English - Humor/Parody - Chapters: 1 - Words: 2,500 - Reviews: 27 - Favs: 77 - Follows: 7 - Published: 4/7/2010 - Beast Boy, Raven - Complete
Goodbye Forever by Freakgonewild reviews
To one wrong move Freddie makes, Sam's Gone Forever...Two-Shot Set in IQuit ICarly. Finished! Thanx to all the reviewers and readers of this and all my other sories thanx!
iCarly - Rated: K+ - English - Tragedy/Hurt/Comfort - Chapters: 2 - Words: 1,274 - Reviews: 8 - Favs: 10 - Follows: 8 - Updated: 4/6/2010 - Published: 1/4/2010 - Sam P., Freddie B. - Complete
Remember me Beastboy remake by BeastBoyfangirl reviews
A fight with plasmus injures Beastboy and leaves him with no memories of who he was with the Titans.Now the Titans have to deal with a whole new side of Beastboy they've never saw. I remade 1st chapter again! Leave review if you think I should remake 2ch
Teen Titans - Rated: T - English - Angst/Romance - Chapters: 3 - Words: 6,180 - Reviews: 38 - Favs: 20 - Follows: 33 - Updated: 4/5/2010 - Published: 11/2/2009 - Beast Boy, Raven
iShip Seddie by babydon'tletmefall reviews
Carly shows Sam and Freddie the wonderful world of FanFiction, she finds out about iCarly FanFiction. What happens when our favorite couple finds out about Seddie? Sweet Seddie of course!
iCarly - Rated: K - English - Romance/Humor - Chapters: 1 - Words: 280 - Reviews: 26 - Favs: 17 - Follows: 1 - Published: 4/2/2010 - Sam P., Freddie B. - Complete
Red Sam by Silver-Creasent-MOON1995 reviews
Suicide Fic. Don't like don't read. Angsty...reviews are love
iCarly - Rated: T - English - Drama/Tragedy - Chapters: 1 - Words: 824 - Reviews: 9 - Favs: 9 - Follows: 3 - Published: 4/1/2010 - Sam P., Freddie B. - Complete
Lab Rat by AnneriaWings reviews
The look on my parents' faces – eager, curious, somewhat hateful – wasn't exactly hard to give away their intentions. I knew what they were going to do to me even before Mom snapped on a pair of rubbery, white latex gloves.
Danny Phantom - Rated: T - English - Angst/Drama - Chapters: 4 - Words: 21,554 - Reviews: 409 - Favs: 1,708 - Follows: 385 - Updated: 4/1/2010 - Published: 10/28/2009 - Danny F. - Complete
April Fools? by purplerayz reviews
Reid has a date, but no one believes him.
Criminal Minds - Rated: K+ - English - Humor - Chapters: 1 - Words: 1,655 - Reviews: 68 - Favs: 330 - Follows: 47 - Published: 4/1/2010 - S. Reid - Complete
iLoathe You by bethbky reviews
Freddie misspells one word in a text message to Sam. Loathe to Love. But what will Princess Puckett do? Reply with a well written text herself of course! Seddie. R&R. Rated T, I used some swears in there.
iCarly - Rated: T - English - Romance/Friendship - Chapters: 1 - Words: 1,075 - Reviews: 13 - Favs: 15 - Follows: 2 - Published: 4/1/2010 - Freddie B., Sam P. - Complete
The Bank Job by ElphieBLW reviews
AU. "You really want to die, don't you? Huh, Protector? 'Cause if that's what you want, I'm more than happy to give it to you!" The gun found itself directly between his eyes. And to think, he was only here on accident....
Danny Phantom - Rated: T - English - Crime/Drama - Chapters: 6 - Words: 10,366 - Reviews: 116 - Favs: 122 - Follows: 62 - Updated: 3/31/2010 - Published: 11/2/2009 - Danny F., Sam M. - Complete
Fight by Wraith Ink-Slinger reviews
Reid gets into a fight with a fellow agent; Morgan is proud, Garcia is angry, and Hotch is attempting to make sense of it all. Two-shot.
Criminal Minds - Rated: T - English - Drama/Friendship - Chapters: 2 - Words: 3,550 - Reviews: 119 - Favs: 883 - Follows: 165 - Updated: 3/29/2010 - Published: 3/27/2010 - S. Reid - Complete
iCan't Believe It by SnarlyMarley reviews
It's Freddie's birthday and Sam and Carly have a surprise for him. While there, Seddie has some realizations. T for language.
iCarly - Rated: T - English - Hurt/Comfort/Romance - Chapters: 15 - Words: 11,150 - Reviews: 24 - Favs: 27 - Follows: 8 - Updated: 3/29/2010 - Published: 3/22/2010 - Freddie B., Sam P. - Complete
iPranked On Christmas by Lovefreak55 reviews
Sam's always playing pranks on Freddie. But when she pull a prank on him for Christmas, he doesn't want to deal with her anymore. Will there be a seddie ending? COMPLETE
iCarly - Rated: K - English - Romance/Friendship - Chapters: 7 - Words: 2,829 - Reviews: 21 - Favs: 9 - Follows: 9 - Updated: 3/29/2010 - Published: 12/4/2009 - Sam P., Freddie B. - Complete
Can you pick me up? by JuliinThesky reviews
His cell phone rang and he knew who was on the other side of the line." Another Seddie One-Shot.. enjoy and RR : Rated T just to be safe.. a little of lenguage maybe...
iCarly - Rated: T - English - Humor/Romance - Chapters: 1 - Words: 1,635 - Reviews: 9 - Favs: 23 - Follows: 2 - Published: 3/28/2010 - Freddie B., Sam P. - Complete
Photoshop Chaos by lazywriter123 reviews
Garcia finally shows everyone her secret collection of photos. Uh oh.
Criminal Minds - Rated: T - English - Humor - Chapters: 1 - Words: 240 - Reviews: 11 - Favs: 16 - Follows: 3 - Published: 3/28/2010 - P. Garcia - Complete
Messages in Liquor Bottles by muchasfandomas reviews
It's Sam's 16th birthday. There's only one problem. She's drunk for the first time in Freddie's bathroom, and he's stuck cleaning up her mess. Will this situation bring them closer together?
iCarly - Rated: T - English - Romance/Humor - Chapters: 7 - Words: 4,515 - Reviews: 22 - Favs: 18 - Follows: 8 - Updated: 3/28/2010 - Published: 3/8/2010 - Sam P., Freddie B. - Complete
Change by lazywriter123 reviews
Spencer makes a change and it has some great results.
Criminal Minds - Rated: T - English - Humor - Chapters: 1 - Words: 339 - Reviews: 8 - Favs: 44 - Follows: 8 - Published: 3/27/2010 - S. Reid - Complete
Goodbye My One And Only by angel-feather-keeper reviews
A very angsty poem. If you wanna cry, read. if ya don't, well, read anyway!Contains death and a crying Danny.
Danny Phantom - Rated: T - English - Angst/Tragedy - Chapters: 1 - Words: 225 - Reviews: 14 - Favs: 9 - Published: 3/22/2010 - Danny F., Sam M. - Complete
That's Why by AwesomeKid and MidnightWriter reviews
Sam shoves Freddie in a closet and naturally, he's a little annoyed. Meanwhile, she searches for her secret snack stash. One shot. Sam/Freddie. Written by just Awesomekid.
iCarly - Rated: K+ - English - Humor - Chapters: 1 - Words: 408 - Reviews: 3 - Favs: 5 - Follows: 1 - Published: 3/22/2010 - Freddie B., Sam P. - Complete
iBecome A Bad Boy by coffee-stained lips reviews
Freddie realizes Carly always falls for the bad boys. So he decides to become one to impress her. But instead of getting Carly, he gets a girl just as bad as his new attitude...Sam!
iCarly - Rated: K+ - English - Romance - Chapters: 12 - Words: 8,731 - Reviews: 56 - Favs: 60 - Follows: 32 - Updated: 3/21/2010 - Published: 2/13/2010 - Sam P., Freddie B. - Complete
Killing Me Quietly by SimplyAMemory reviews
Freddie can't stop thinking about his kiss with Sam. And just by telling Carly about it, he turns their lives upsidown. Because sometimes, ears hear things that mouth's shouldn't have spoken. Seddie.
iCarly - Rated: T - English - Romance/Mystery - Chapters: 12 - Words: 12,502 - Reviews: 126 - Favs: 38 - Follows: 43 - Updated: 3/21/2010 - Published: 1/4/2009 - Freddie B., Sam P. - Complete
iNub by JerseyJustGotColder reviews
Does anyone know the REAL definition for nub? SamxFreddie SEDDIE one-shot
iCarly - Rated: K+ - English - Romance/Friendship - Chapters: 1 - Words: 708 - Reviews: 21 - Favs: 25 - Follows: 2 - Published: 3/20/2010 - Freddie B., Sam P. - Complete
iDo Something Crazy by Mlle. Madeline reviews
And it's the look in her eyes that drives Freddie to do the craziest thing he's ever done...
iCarly - Rated: T - English - Romance/Drama - Chapters: 1 - Words: 550 - Reviews: 16 - Favs: 32 - Follows: 2 - Published: 3/19/2010 - Freddie B., Sam P. - Complete
A Strange Love by Erich Zann III reviews
Freddie finally works up the courage to tell Sam how he feels... Sort of. Does Sam feel the same way? Duh! Major smut. Don't like smut? Don't read. Don't like FreddiexSam? Don't read.
iCarly - Rated: M - English - Romance/Humor - Chapters: 1 - Words: 2,751 - Reviews: 14 - Favs: 46 - Follows: 12 - Published: 3/19/2010 - Freddie B., Sam P. - Complete
Alice's Midnight Snack by Cry4theDevil reviews
Drabble, this time Alice see's more than she bargained for and the Hatter isn't naive as he seems. Hatter/Alice rated T for nudity non graphic
Alice in Wonderland, 2010 - Rated: T - English - Mystery - Chapters: 1 - Words: 818 - Reviews: 61 - Favs: 78 - Follows: 24 - Published: 3/11/2010 - Alice K., Mad Hatter/Tarrant Hightopp - Complete
Be Back Before You Know It by Cry4theDevil reviews
Drabble, a scene in the Alice in Wonderland 2010 movie that could've been more than it was. Hatter/Alice
Alice in Wonderland, 2010 - Rated: K+ - English - Romance - Chapters: 1 - Words: 735 - Reviews: 28 - Favs: 66 - Follows: 15 - Published: 3/11/2010 - Alice K., Mad Hatter/Tarrant Hightopp - Complete
Extraordinary by Cry4theDevil reviews
Drabble, a scene between Hatter and Alice that could've been a kiss.
Alice in Wonderland, 2010 - Rated: K - English - Romance - Chapters: 1 - Words: 1,059 - Reviews: 18 - Favs: 46 - Follows: 7 - Published: 3/11/2010 - Alice K., Mad Hatter/Tarrant Hightopp - Complete
Family by tikki-tock reviews
They were a family of sorts, the usual participants of the Tea Party. The Hatter has a realization when discussing such with Alice one night.
Alice in Wonderland, 2010 - Rated: K+ - English - Romance/Angst - Chapters: 1 - Words: 1,146 - Reviews: 57 - Favs: 78 - Follows: 7 - Published: 3/10/2010 - Alice K., Mad Hatter/Tarrant Hightopp - Complete
Father Figure by purplerayz reviews
Reid's father shows up at his apartment for a visit, and Reid soon finds out that his intentions are nowhere near good.
Criminal Minds - Rated: M - English - Drama/Angst - Chapters: 12 - Words: 6,804 - Reviews: 61 - Favs: 226 - Follows: 67 - Updated: 3/9/2010 - Published: 2/26/2010 - S. Reid - Complete
iHate Hospitals by Winteroses reviews
Sam needs surgery right before going into it she confesses her love for Freddie or was it just the laughing gas? A response to Smartbabie's Seddie Challenge.
iCarly - Rated: K+ - English - Romance/Hurt/Comfort - Chapters: 2 - Words: 3,027 - Reviews: 16 - Favs: 21 - Follows: 4 - Updated: 3/8/2010 - Published: 3/4/2010 - Freddie B., Sam P. - Complete
ICan't Take Him Anymore by WerewolfGirl4life reviews
Sam's got a boyfriend, who constantly beats her! How long can she hide it, and how long will it be before a certain "dork" will find out? And can he save her before its to late? Read and find out! Rated T for vilence and langauge!
iCarly - Rated: T - English - Hurt/Comfort/Romance - Chapters: 12 - Words: 8,532 - Reviews: 52 - Favs: 24 - Follows: 28 - Updated: 3/7/2010 - Published: 8/28/2009 - Sam P., Freddie B.
After the Fall by Scooter12345 reviews
Special thank to v-hills for the story that half inspired this. Basically what it says what happens after Flint and Sam's first kiss. Plus a little something you didn't know about Flint Lockwood.
Cloudy with a Chance of Meatballs - Rated: T - English - Friendship/Romance - Chapters: 1 - Words: 832 - Reviews: 11 - Favs: 18 - Follows: 2 - Published: 3/6/2010 - Complete
More Than Gummy Bears by Scooter12345 reviews
A week after his mother dies Flint is pushed over the edge and someone knows what to say when no one else knows how to help. Really sad, in my mind, For Animation Universe because I loved song for my mother. Could be a chapter to a longer fic.
Cloudy with a Chance of Meatballs - Rated: T - English - Friendship/Hurt/Comfort - Chapters: 1 - Words: 389 - Reviews: 7 - Favs: 13 - Follows: 3 - Published: 3/2/2010 - Complete
Stolen Memories by Wiccan98 reviews
When Ginny was 8yrs old something terrible and tramatic happened to her. Her parents didn't think she could handle it and had the Medi-Wizards erase her memories of it. Now, eight years later-- FULL SUMMARY INSIDE. Rated M. Contains self-mutilation. D/G
Harry Potter - Rated: M - English - Drama/Romance - Chapters: 32 - Words: 126,591 - Reviews: 766 - Favs: 307 - Follows: 197 - Updated: 2/28/2010 - Published: 5/25/2009 - Ginny W., Draco M. - Complete
Seddie Note by Mixwe reviews
Freddie finds a note taped to his locker, he thinks it's from Sam. I LOVE THIS ONE! THE END IS THE BEST PART! SEDDIE SEDDIE SEDDIE!
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 738 - Reviews: 23 - Favs: 37 - Follows: 5 - Published: 2/22/2010 - Freddie B., Sam P. - Complete
Ok I'll Confess by JuliinThesky reviews
Samantha Puckett doesn’t cry. And Samantha Puckett doesn’t like tech nerds with psycho moms but I like one so yes... I WANNA FRIKIN CRY! It's a short one hope u like it : RR PLEASE :
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 1,149 - Reviews: 5 - Favs: 13 - Follows: 1 - Published: 2/22/2010 - Sam P., Freddie B. - Complete
The Ways We Hurt by too many stars to count reviews
Beast Boy works hard to have the image of team jokster. But what happens when that image starts to shatter? Will the team be able to help him? More importantly will he let them? And what about everyone else's problems? BB/R & R/S Please R&R!
Teen Titans - Rated: M - English - Romance/Angst - Chapters: 11 - Words: 72,464 - Reviews: 107 - Favs: 146 - Follows: 129 - Updated: 2/22/2010 - Published: 1/20/2008 - Beast Boy, Raven
Cuddling by JerseyJustGotColder reviews
6 year old Sam heard a funny word. Wondering what it meant, she asked her best friend. This started her favorite tradition that lasted for over 11 years. ONESHOT rated K for HEAVY fluff
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 1,121 - Reviews: 21 - Favs: 39 - Follows: 5 - Published: 2/21/2010 - Freddie B., Sam P. - Complete
Logan by FireHeart19 reviews
After Beastboy and Raven have a moment, Beastboy, thinking Raven is mad at him, runs away. years later a new hero appears, and the team gets a surprise.
Teen Titans - Rated: T - English - Romance - Chapters: 1 - Words: 3,053 - Reviews: 9 - Favs: 31 - Follows: 9 - Published: 2/20/2010 - Beast Boy, Raven - Complete
Hero by xXACCEBXx reviews
Something's wrong, and he know's it. He's saved one of his best friend's lives before, but this time it's Sam, and she needs help more than he could have ever imagined. But maybe he can be her hero.
iCarly - Rated: T - English - Romance/Angst - Chapters: 1 - Words: 2,243 - Reviews: 16 - Favs: 53 - Follows: 3 - Published: 2/19/2010 - Freddie B., Sam P. - Complete
Just Getting By by AhiFlame reviews
Midquel to Anastasia. The story details how Vlad and Dimitri met and formed the bond they share, as well as the adventures they had before the bulk of the movie takes place. Slash-free!
Anastasia - Rated: K+ - English - Adventure - Chapters: 3 - Words: 5,037 - Reviews: 7 - Favs: 13 - Follows: 10 - Updated: 2/16/2010 - Published: 1/24/2010
An Alternative For Roses by 7-LunaAbraxos-7 reviews
It's Valentines Day in the Tower and BB decides to give Raven the proper flowers of Valentines. BBxRae fluff.
Teen Titans - Rated: K+ - English - Romance - Chapters: 1 - Words: 1,497 - Reviews: 18 - Favs: 67 - Follows: 4 - Published: 2/14/2010 - Beast Boy, Raven - Complete
Overheard by JamesTheGreater reviews
Sam eavesdrops on a conversation between Freddie and Gibby and she hears some...interesting things. One-shot. T for suggestive seddie.
iCarly - Rated: T - English - Humor/Romance - Chapters: 1 - Words: 1,859 - Reviews: 57 - Favs: 106 - Follows: 7 - Published: 2/13/2010 - Sam P., Freddie B. - Complete
iHate it, But I Love it by missweird101 reviews
1st story i wrote. no bad words, dont think little kids want to read a romance thing. sorry somethings messed up, 2nd chapter wont work. What happens when Freddie and Sam find the truth behind their father's deaths?
iCarly - Rated: T - English - Romance/Hurt/Comfort - Chapters: 11 - Words: 7,380 - Reviews: 24 - Favs: 8 - Follows: 5 - Updated: 2/11/2010 - Published: 1/21/2010 - Freddie B., Sam P. - Complete
You can't have my son! by Discarded Ideas reviews
A desperate plea from a mother to the woman who is holding her son's heart hostage, told from the perspective of Mrs. Benson. A Seddie oneshot.
iCarly - Rated: T - English - Romance/Angst - Chapters: 1 - Words: 1,618 - Reviews: 18 - Favs: 30 - Follows: 1 - Published: 2/11/2010 - Sam P., Freddie B. - Complete
Spencer wants a Pet by lazywriter123 reviews
Buying a new pet is annoying but what kind of pet will Reid get? Rated K for too much cuteness!
Criminal Minds - Rated: K+ - English - Humor - Chapters: 1 - Words: 390 - Reviews: 14 - Favs: 31 - Follows: 5 - Published: 2/10/2010 - S. Reid - Complete
It's Not True, I Tell You by VociferousVixenofDarkness reviews
Another Poe inspired piece. Raven decides to delve into BB's mind when she notices his disappointment.
Teen Titans - Rated: K+ - English - Poetry/Romance - Chapters: 1 - Words: 839 - Reviews: 6 - Favs: 8 - Published: 2/8/2010 - Raven, Beast Boy - Complete
A gift that likes to poke its nose into EVERYTHING by little Princess unicorn reviews
Sam's dad is a scientist,when he gives her his latest project, can it help but poke its nose into things? What secrets will be spilt?... SEDDIE!
iCarly - Rated: T - English - Romance/Fantasy - Chapters: 4 - Words: 1,787 - Reviews: 14 - Favs: 4 - Follows: 6 - Updated: 2/8/2010 - Published: 9/28/2009 - Sam P., Freddie B.
iNeed Help by waterprincess615 reviews
Sam's got a problem and she seeks help from someone she least expects. Seddie shipping, Rated T because it's a little angsty. I do not own iCarly or any of its characters.
iCarly - Rated: T - English - Angst/Hurt/Comfort - Chapters: 11 - Words: 7,808 - Reviews: 8 - Favs: 11 - Follows: 11 - Updated: 2/8/2010 - Published: 1/9/2010 - Sam P., Freddie B.
An Invitation You Never Wanted by RavenFollower13 reviews
When the Titans decide to celebrate July 4th, Beast Boy plans a Masked Ball that all Titans are invited to. So why does a promise set a certain sister off that the Titans didn't even know about? Beast Boy and Raven fanfic. Enjoy!
Teen Titans - Rated: T - English - Romance/Horror - Chapters: 16 - Words: 57,017 - Reviews: 58 - Favs: 88 - Follows: 24 - Updated: 2/7/2010 - Published: 7/4/2009 - Beast Boy, Raven - Complete
iAm Coming Home by musicfreak291 reviews
When Freddie leaves home for three years, will Sam take him back after so long. Songfic
iCarly - Rated: K - English - Romance - Chapters: 1 - Words: 1,746 - Reviews: 14 - Favs: 21 - Follows: 2 - Published: 2/5/2010 - Freddie B., Sam P. - Complete
The Green Files by The Lady Bonny reviews
You know he is a Titan called Beast Boy but his real name is Garfield. You know he is green and tells jokes. You know there must be more to him than that...and you're right. A series of drabbles and oneshots about Beast Boy.
Teen Titans - Rated: T - English - Chapters: 51 - Words: 94,533 - Reviews: 854 - Favs: 529 - Follows: 293 - Updated: 2/3/2010 - Published: 6/6/2006 - Beast Boy, Raven
Comatose by Susilo reviews
A selfless sacrifice forces Beast Boy into a coma. Injured and unconscious, Garfield finds out that people in a comatose state really can hear things that go on around him. Too bad he came to that realization the hard way.
Teen Titans - Rated: T - English - Romance/Angst - Chapters: 6 - Words: 37,563 - Reviews: 176 - Favs: 168 - Follows: 221 - Updated: 2/3/2010 - Published: 7/12/2007 - Beast Boy, Raven
For the Love of Baked Goods by Wraith Ink-Slinger reviews
An embarrassing slip of the tongue brought on by caffeine deprivation and muffins earns Reid some teasing. A tiny hint of Reid/Garcia, more friendship than anything. Oneshot
Criminal Minds - Rated: K+ - English - Humor/Friendship - Chapters: 1 - Words: 1,513 - Reviews: 32 - Favs: 88 - Follows: 19 - Published: 2/2/2010 - S. Reid, P. Garcia - Complete
The Seventeenth Year by saralynn92 reviews
A tragedy strikes the Flynn-Fletcher home, leaving the brother of the victim to tell the horrible tale. Not for the faint of heart, kiddies. Read with caution.
Phineas and Ferb - Rated: M - English - Tragedy/Family - Chapters: 1 - Words: 5,264 - Reviews: 48 - Favs: 68 - Follows: 7 - Published: 1/31/2010 - Phineas, Ferb - Complete
Human Trafficking by Sovoyita reviews
Taken by men who are going to rent me out to strangers that will take advantage of me…Brilliant. This wasn’t bad luck. It was my sentence to hell. Rated M for adult themes including rape and slavery.
Twilight - Rated: M - English - Romance/Drama - Chapters: 15 - Words: 41,562 - Reviews: 376 - Favs: 234 - Follows: 327 - Updated: 1/29/2010 - Published: 1/1/2009 - Bella, Edward
Caught in the scene of the movie! by blackrose3612 reviews
So, if the Titans have scary movies and such, it got me wondering: 'why can't they have Disney movies' And my BBxRae oriented mind began stirring and left me with this fluffy little story about how BB discovers Raven's secret obsession! review please!
Teen Titans - Rated: K+ - English - Romance/Humor - Chapters: 2 - Words: 4,455 - Reviews: 14 - Favs: 27 - Follows: 7 - Updated: 1/26/2010 - Published: 1/20/2010 - Beast Boy, Raven - Complete
Say Hello Seattle by Happenstancelove reviews
Freddie finally grows facial hair. Will Sam help save Freddie from his mother's extremely painful and permanent measures? Will hilarity and embarrassment ensue? I think so! songfic based on "Hello Seattle" by Owl City
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 6,446 - Reviews: 15 - Favs: 25 - Published: 1/25/2010 - Freddie B., Sam P. - Complete
Pieces of Love by SaiyanLover reviews
Glimpses into the unconventional romance between Raven and Beast Boy - two polar opposites who unexpectedly manage to complete each other perfectly. This is a collection of independent stories. Rated for sexual references and language.
Teen Titans - Rated: T - English - Romance/Friendship - Chapters: 38 - Words: 25,969 - Reviews: 565 - Favs: 226 - Follows: 151 - Updated: 1/23/2010 - Published: 12/4/2008 - Beast Boy, Raven
iChange by SoRawrandStuff reviews
Season 1 Freddie and Sam come back with some questions for Season 3 Sam and Freddie.
iCarly - Rated: K - English - Humor/Friendship - Chapters: 1 - Words: 1,969 - Reviews: 11 - Favs: 20 - Follows: 2 - Published: 1/21/2010 - Freddie B., Sam P. - Complete
Beast Boy and Raven: The perfect couple? by Neptopolis5 reviews
Beast Boy and Raven have been going out for months. However, when Beast Boy finds something in Raven's room, it changes their relationship forever.
Teen Titans - Rated: K+ - English - Hurt/Comfort - Chapters: 1 - Words: 1,214 - Reviews: 35 - Favs: 11 - Follows: 6 - Published: 1/20/2010 - Beast Boy, Raven - Complete
I Don't Care by airekuh reviews
Where was Sam during Carly and Freddie's romantic tryst? A missing moment fic from iSaved Your Life. One-sided Seddie. One-shot.
iCarly - Rated: K - English - Angst/Romance - Chapters: 1 - Words: 749 - Reviews: 10 - Favs: 15 - Follows: 2 - Published: 1/19/2010 - Sam P., Freddie B. - Complete
iKiss on iCarly by coffee-stained lips reviews
What would've happened if Freddie told SAM he'd never been kissed? What would've happened if it was on-air when it happened?
iCarly - Rated: K - English - Friendship/Romance - Chapters: 9 - Words: 5,202 - Reviews: 36 - Favs: 44 - Follows: 28 - Updated: 1/18/2010 - Published: 1/9/2010 - Sam P., Freddie B. - Complete
Insomnia by Raven's Favorite Emotion reviews
Because sometimes you just can't sleep. R/BB
Teen Titans - Rated: T - English - Romance/Horror - Chapters: 1 - Words: 4,345 - Reviews: 34 - Favs: 95 - Follows: 8 - Published: 1/14/2010 - Raven, Beast Boy - Complete
iLie by SheriffBoB reviews
Of course I lie. You all know it. Everyone lies sometimes. But, not about their whole lives. Seddie.
iCarly - Rated: T - English - Romance/Friendship - Chapters: 10 - Words: 6,857 - Reviews: 50 - Favs: 17 - Follows: 22 - Updated: 1/12/2010 - Published: 11/16/2008 - Sam P., Freddie B.
iCan't Believe It by plinkerton reviews
LOTS OF SHEX :D It's Seddie. ; Not for the little children :D Sam and Freddie get drunk ONOEZ SEX :D
iCarly - Rated: M - English - Romance/Friendship - Chapters: 1 - Words: 1,950 - Reviews: 28 - Favs: 47 - Follows: 24 - Published: 1/11/2010 - Freddie B., Sam P.
iPretend by RedRoseRebel reviews
We all know Sam has a twin sister, but what if Melanie never went on a date with Freddie? What if it was Sam instead, pretending to be Melanie? Set during iTwins. Seddie one-shot.
iCarly - Rated: K - English - Romance - Chapters: 1 - Words: 1,299 - Reviews: 12 - Favs: 25 - Follows: 3 - Published: 1/11/2010 - Freddie B., Sam P. - Complete
Drawing the Raven by AKosh reviews
Cyborg bet that BB couldn't draw. Sadly for Raven, she needs to help him prove he can. Just a one-shot.
Teen Titans - Rated: K+ - English - Humor/Romance - Chapters: 1 - Words: 2,335 - Reviews: 17 - Favs: 63 - Follows: 6 - Published: 1/10/2010 - Raven, Beast Boy - Complete
The Promise by Raven2k8 reviews
Beast Boy made a promise to himself a long time ago, and Raven is going to find out what it is, real soon. Songfic to "The Promise" by When in Rome. Dedicated to Author Penholder!
Teen Titans - Rated: K+ - English - Romance - Chapters: 1 - Words: 2,968 - Reviews: 10 - Favs: 32 - Follows: 2 - Published: 1/10/2010 - Raven, Beast Boy - Complete
Freddie's Got a Gun! by Archilochus reviews
When Freddie sneaks in to watch Sam's beauty pageant performance, he hopes to get some dirt on her. But will he, or will the joke be on Freddie?
iCarly - Rated: T - English - Humor - Chapters: 1 - Words: 1,794 - Reviews: 7 - Favs: 17 - Follows: 3 - Published: 1/8/2010 - Freddie B., Sam P. - Complete
iKiss kiss kiss by whosconfused reviews
what happens when the gang goes to a basket ball game and sam and freddie encounter the kiss cam?
iCarly - Rated: K+ - English - Humor/Romance - Chapters: 1 - Words: 998 - Reviews: 14 - Favs: 40 - Follows: 2 - Published: 1/8/2010 - Freddie B., Sam P. - Complete
iHate Hurting by iCarlyFanFreek825 reviews
If torturing myself was what I had to do to keep Freddie, then I was going to do it. One sided one-shot. Sam likes Freddie, but Carly has already stolen his heart.
iCarly - Rated: K+ - English - Hurt/Comfort - Chapters: 1 - Words: 658 - Reviews: 12 - Favs: 9 - Follows: 3 - Published: 1/7/2010 - Sam P., Freddie B. - Complete
Ibreakbones by dothepepperminttwist reviews
Freddie was so sick of Sam! So what happens when he pushes her a little, just to show who's really boss? Who's the real victim here? Add in a polite social worker, a spazzy spencer and a bit of a paranoid Mrs. Benson and some, er, surprises! seddie!
iCarly - Rated: T - English - Humor/Romance - Chapters: 14 - Words: 7,046 - Reviews: 75 - Favs: 13 - Follows: 14 - Updated: 1/7/2010 - Published: 10/25/2009 - Freddie B., Sam P.
What's Wrong With Me? by Glued To The Keyboard reviews
Freddie fainted during school and it rushed to hospital,where no one seems to know whats wrong. he pushes everyone out- Can a certain blonde haired demon help him deal with being sick? Of course,Sams gonna need some help too when her life starts to suck..
iCarly - Rated: T - English - Hurt/Comfort/Angst - Chapters: 9 - Words: 11,870 - Reviews: 67 - Favs: 42 - Follows: 30 - Updated: 1/2/2010 - Published: 11/1/2009 - Freddie B., Sam P. - Complete
faded from the winter by vega-de-la-lyre reviews
There is a girl behind the curtains, sitting curled up on the windowsill, elbow pressed against the glass. Anya and Dimitri, pre-movie.
Anastasia - Rated: K - English - Chapters: 1 - Words: 1,683 - Reviews: 13 - Favs: 89 - Follows: 8 - Published: 1/1/2010 - Complete
iWon't Let You Go by BananaPuddingIsMyFriend reviews
Sam and Freddie are due for another installment of Wake Up Spencer, but something terribly wrong happens. Seddie fanfic.
iCarly - Rated: K - English - Humor/Romance - Chapters: 1 - Words: 767 - Reviews: 8 - Favs: 20 - Follows: 3 - Published: 12/31/2009 - Freddie B., Sam P. - Complete
Revenge Is Sweet by Wraith Ink-Slinger reviews
Reid runs in to one of his old high school class mates and is pleased with the way things turned out. Oneshot.
Criminal Minds - Rated: K+ - English - Humor - Chapters: 1 - Words: 1,026 - Reviews: 49 - Favs: 373 - Follows: 52 - Published: 12/31/2009 - S. Reid - Complete
From Rachel to Raven by Dude Your Awesome8 reviews
BBxRae ; Rachel and Garfield are the greatest friends anyone has ever seen. The only thing bad about Rachel's life is everything else. She wishes to leave it, and that's what she gets and finally gets to start a new life. Only now she needs to go back.
Teen Titans - Rated: K+ - English - Adventure/Friendship - Chapters: 14 - Words: 25,036 - Reviews: 63 - Favs: 28 - Follows: 16 - Updated: 12/30/2009 - Published: 11/15/2009 - Beast Boy, Raven - Complete
Pretty Boy by Wraith Ink-Slinger reviews
A possible lead in a case is being stingy with information and the girls hatch a plan to get what they need that, unfortunately, involves Reid. A little bit of everyone. Oneshot
Criminal Minds - Rated: K+ - English - Humor/Friendship - Chapters: 1 - Words: 2,250 - Reviews: 43 - Favs: 251 - Follows: 40 - Published: 12/29/2009 - S. Reid - Complete
Blip by Alex aka Numbuh 145362 reviews
Rae, wait for me!’ Blip blip blip. Just some harmless RaeBB fluff. Mentions death Constructive Criticism wanted, because it’s my first Teen Titans Fanfic!
Teen Titans - Rated: K+ - English - Hurt/Comfort/Romance - Chapters: 1 - Words: 449 - Reviews: 7 - Favs: 10 - Follows: 1 - Published: 12/27/2009 - Beast Boy, Raven - Complete
iDidn't Know Sam Could Figure Skate by S.Nova17 reviews
Sam was taught to skate as a little girl, however, Freddie had no idea. Carly on the other hand knows another one of Sam's secrets in which Freddie is also about to find out. Fluffy Seddie One-Shot.
iCarly - Rated: T - English - Humor/Romance - Chapters: 1 - Words: 766 - Reviews: 16 - Favs: 29 - Follows: 5 - Published: 12/27/2009 - Freddie B., Sam P. - Complete
The Thirty Second Word by ArtsyChick reviews
“I need a dress.” I felt my face getting hot. “Not for me, of course. For my friend. She’s a girl.”
Anastasia - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 2,066 - Reviews: 30 - Favs: 106 - Follows: 16 - Published: 12/23/2009 - Complete
iWant Hot Wheels by JamesLily96 reviews
When Freddie and Sam see each other at a toy store when they were little, Freddie thinks it's odd that Sam wants Hot Wheels for Christmas. What happens when Freddie finally gets Sam what she wants.... Just a cute Seddie oneshot!
iCarly - Rated: K+ - English - Friendship/Humor - Chapters: 1 - Words: 677 - Reviews: 17 - Favs: 21 - Follows: 3 - Published: 12/21/2009 - Freddie B., Sam P. - Complete
i'LL Remember You by mpkio2 reviews
Seqeul to "i'M Here For You". Freddie is dead. His family and friends are grieving his loss...except for one blonde-haired girl. Based on the song "I'll Remember You" by No Secrets. One-Shot. Seddie. Rated K
iCarly - Rated: K+ - English - Angst/Hurt/Comfort - Chapters: 3 - Words: 5,723 - Reviews: 16 - Favs: 12 - Follows: 4 - Updated: 12/21/2009 - Published: 8/26/2009 - Sam P., Freddie B. - Complete
Coming Back by sappyhalmarkgreetingsaremylife reviews
After Danny left, lost in the ghost zone, Sam and Tucker never lost hope. So when he comes back after about 2 years, how much has he changed? Is he still the real Danny or someone completely different? Or could he be someone Sam may like even more?
Danny Phantom - Rated: T - English - Romance/Sci-Fi - Chapters: 3 - Words: 3,331 - Reviews: 16 - Favs: 24 - Follows: 21 - Updated: 12/18/2009 - Published: 11/28/2009 - Danny F., Sam M.
Momma Loves Her Chicken by Technician Fan reviews
Just a cute little one-shot fic that I wrote after watching iQuit iCarly. Freddie's reaction to when, after saving Carly, Sam nearly fell off. SPOILERS FOR IQUIT ICARLY! Seddie!
iCarly - Rated: K+ - English - Humor/Romance - Chapters: 2 - Words: 1,172 - Reviews: 20 - Favs: 21 - Follows: 1 - Updated: 12/15/2009 - Published: 12/7/2009 - Freddie B., Sam P. - Complete
Soft Spot by Wraith Ink-Slinger reviews
Reid agrees to adopt a cat and is now having trouble naming it. Has a little bit of everyone in it. Oneshot.
Criminal Minds - Rated: K+ - English - Humor - Chapters: 1 - Words: 1,571 - Reviews: 34 - Favs: 153 - Follows: 15 - Published: 12/12/2009 - S. Reid - Complete
iHave Leukimia by Lchick354 reviews
It's my first story. Read and review
iCarly - Rated: K+ - English - Tragedy - Chapters: 8 - Words: 3,735 - Reviews: 26 - Favs: 8 - Follows: 10 - Updated: 12/12/2009 - Published: 7/14/2009 - Sam P.
iHate Tension by musicfreak291 reviews
Teenager's needs can become a little too much to handle sometimes. How does Sam and Freddie cope with the Tension between the two. Sexual Tension that is.
iCarly - Rated: M - English - Romance/Drama - Chapters: 5 - Words: 8,350 - Reviews: 86 - Favs: 102 - Follows: 37 - Updated: 12/10/2009 - Published: 10/3/2009 - Sam P., Freddie B. - Complete
Always a Con Artist by Cirolane reviews
He wasn't sure what she had expected. For them to settle down? For him to have one honest job, where he would work all day to pay for their shitty apartment? Deep down she probably knew that could never last long, and it didn't. Anya/Dmitri, post movie.
Anastasia - Rated: K - English - Romance - Chapters: 1 - Words: 520 - Reviews: 20 - Favs: 73 - Follows: 6 - Published: 12/9/2009 - Complete
An Unsuccessful Snatch by Cirolane reviews
Post movie: Anya and Dmitri have a game they play.
Anastasia - Rated: K - English - Chapters: 1 - Words: 522 - Reviews: 15 - Favs: 72 - Follows: 5 - Published: 12/7/2009 - Complete
i60's dance by HeyBulldogProductions reviews
Sequal to iAm the fifth Beatle. When Freddie and Sam are foreced to go to a dance together what will happen? But SOMEONE will kiss at midnight during the last dance. Who could it be? Sam/Freddie, Wendy/Gibby, Tyler/Carly. and SOMEONE gets married!
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 1,585 - Reviews: 3 - Favs: 7 - Follows: 4 - Published: 12/6/2009 - Freddie B., Sam P.
iSaw A Flash Of Red by bethbky reviews
Her expression scares me. I haven't had a look like that since... "Freddork?" Freddie moves to L.A to pursue his career as a photographer, leaving Sam and Carly behind. But what happens when he meets a familiar face? Freddie's POV
iCarly - Rated: K+ - English - Romance/Drama - Chapters: 4 - Words: 3,799 - Reviews: 6 - Favs: 7 - Follows: 1 - Published: 12/6/2009 - Freddie B., Sam P. - Complete
iCan't Cry by RECH2O reviews
What did Sam really do when she left the Groovy Smoothie after seeing Freddie and Carly dancing in ispeed date? What if she was upset? What if she cryed? A quick one shot on what Sam was thinking about Carly and freddie's dance. Seddie
iCarly - Rated: K+ - English - Romance - Chapters: 1 - Words: 650 - Reviews: 14 - Favs: 13 - Follows: 4 - Published: 12/5/2009 - Sam P., Freddie B. - Complete
iAm the Fifth Beatle by HeyBulldogProductions reviews
Freddie's mom's been keeping a secert from him. His grandfather is Paul McCartney. Also Mrs. Benson and Spencer go to a hygine convention in Florida but things don't always turn out how you planned. Seddie/Spenson
iCarly - Rated: K+ - English - Humor/Friendship - Chapters: 6 - Words: 9,165 - Reviews: 13 - Favs: 8 - Follows: 10 - Updated: 12/4/2009 - Published: 11/27/2009 - Freddie B., Sam P. - Complete
iLose Control by BarianQueen reviews
*COMPLETE* *Freddie/Sam* *Spencer/Grace* "Six, five, four, three..." Freddie's fangs grew, so close to piercing her skin. "Two, one....HAPPY NEW YEAR!" Everyone shouted it, and that was when Sam felt the pain. Sequel to iHave Been Bitten. MORE VAMPIRES!
iCarly - Rated: M - English - Romance/Drama - Chapters: 9 - Words: 8,722 - Reviews: 76 - Favs: 39 - Follows: 17 - Updated: 12/4/2009 - Published: 11/17/2009 - Freddie B., Sam P. - Complete
Kiss My Eyes and Lay Me to Sleep by Fishing4Karma reviews
Takes place between Apprentice 1&2. Beastboy cant sleep, or rather he refuses to. Its because he... Well i can't tell you or it will ruin it! Flames welcomed, how else will I learn. Title from AFI Prelude 12/21. ONESHOT!
Teen Titans - Rated: T - English - Hurt/Comfort/Angst - Chapters: 1 - Words: 3,754 - Reviews: 9 - Favs: 26 - Follows: 4 - Published: 12/3/2009 - Beast Boy, Raven - Complete
iAm Gay by deviocity reviews
Sam keeps taking jabs at Freddie’s masculinity. He does the only thing he could think of to make her stop. Seddie.
iCarly - Rated: T - English - Romance - Chapters: 1 - Words: 2,840 - Reviews: 69 - Favs: 157 - Follows: 22 - Published: 12/1/2009 - Sam P., Freddie B. - Complete
iAm a Ballerina by S.Nova17 reviews
Sam has a secret. She's been living a double life, and now, with an upcoming recital, she has to find a way to make her friends less suspicious and no one can find out. What happens when a certain tech-nerd does? Challenged by Smartbabie.
iCarly - Rated: T - English - Romance/Humor - Chapters: 10 - Words: 15,530 - Reviews: 90 - Favs: 38 - Follows: 35 - Updated: 11/30/2009 - Published: 8/19/2009 - Sam P., Freddie B. - Complete
Unsure by Nikki9110 reviews
Freddie is pretending to be someone he's not to make new friends. What he doesn't realize is he's turning away the one person who's opinion truely matters. ---- Seddie. Rated T just in case ;
iCarly - Rated: T - English - Romance - Chapters: 8 - Words: 4,473 - Reviews: 24 - Favs: 11 - Follows: 8 - Updated: 11/29/2009 - Published: 1/18/2009 - Sam P., Freddie B. - Complete
Time of Her Life by NightHowl462 reviews
Raven gets a disease that has no cure. She doesn't tell anyone and she and Beast Boy are ordered to stay behind and partol the city when the rest of the team go on a bigger mission. Will she be okay? BBRAE
Teen Titans - Rated: T - English - Romance/Tragedy - Chapters: 10 - Words: 9,968 - Reviews: 69 - Favs: 60 - Follows: 15 - Updated: 11/29/2009 - Published: 11/1/2009 - Beast Boy, Raven - Complete
Too Late by blueflower1594 reviews
Rage really takes over Raven when she tells BeastBoy she wants him to die. Will her horrible wish come true?
Teen Titans - Rated: T - English - Romance/Tragedy - Chapters: 1 - Words: 3,048 - Reviews: 24 - Favs: 35 - Follows: 9 - Published: 11/28/2009 - Beast Boy, Raven - Complete
Stronger Than That by Tech-Man reviews
Danny has been seriously injured in a battle with Skulker and turned up in a comma; Sam and Tucker have gone in search of the secret behind Skulker’s latest upgrade. Danny meets a new ghost, and Sam must confront her feelings about Danny. D&S
Danny Phantom - Rated: T - English - Adventure/Romance - Chapters: 6 - Words: 11,173 - Reviews: 35 - Favs: 16 - Follows: 16 - Updated: 11/27/2009 - Published: 8/31/2009 - Danny F., Sam M.
The Music Inside Us by findtheecho reviews
Ten songs, ten moments between Sam and Freddie. Clearly Seddie. Challenge fic.
iCarly - Rated: T - English - Romance/Friendship - Chapters: 1 - Words: 3,188 - Reviews: 4 - Favs: 6 - Follows: 1 - Published: 11/26/2009 - Freddie B., Sam P. - Complete
iCan't See You by BarianQueen reviews
*COMPLETE*The car came so fast, I didn't even have time to blink. The pain came faster. I passed out before the ambulance arrived. My name is Freddie Benson, and this is my story. *Seddie* All Told In First Point Of View!
iCarly - Rated: T - English - Romance/Angst - Chapters: 12 - Words: 13,162 - Reviews: 90 - Favs: 50 - Follows: 27 - Updated: 11/26/2009 - Published: 11/16/2009 - Freddie B., Sam P. - Complete
iSee You There by FeigningInterest reviews
He shoots me a half smile and returns my eye roll. “I can’t believe you collect fortune cookie notes, Sam.”
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 1 - Words: 2,995 - Reviews: 19 - Favs: 33 - Follows: 1 - Published: 11/25/2009 - Sam P., Freddie B. - Complete
iGo Too Far by Kassaremidybelljesslynn reviews
Sam pulls yet another prank on Freddie. But this one seems to hit closer to home that all the others. Maybe she should’ve left Freddie alone this time. Tell me if the rating is too low.
iCarly - Rated: K+ - English - Romance - Chapters: 1 - Words: 1,887 - Reviews: 8 - Favs: 15 - Follows: 3 - Published: 11/24/2009 - Freddie B., Sam P. - Complete
Freddie by Archilochus reviews
After celebrating the first official webcast of iCarly, Freddie has a nightmare. Except this wasn't any dream; this actually happened. And Sam is the only one who can understand.
iCarly - Rated: K+ - English - Hurt/Comfort/Tragedy - Chapters: 1 - Words: 1,817 - Reviews: 19 - Favs: 26 - Follows: 2 - Published: 11/23/2009 - Sam P., Freddie B. - Complete
iHave Been Bitten by BarianQueen reviews
*COMPLETE* Freddie goes missing one night, and Sam finds him the next day, bloody and laying unconscious on the ground. But then he starts acting strange, avoiding the sun and Sam at all costs... *Seddie*
iCarly - Rated: T - English - Romance/Fantasy - Chapters: 17 - Words: 18,451 - Reviews: 159 - Favs: 66 - Follows: 27 - Updated: 11/17/2009 - Published: 11/1/2009 - Freddie B., Sam P. - Complete
Beautiful Music by Moony3003 reviews
After the case is finally solved in New Orleans, Reid goes back to the club to see Ethan play. Oneshot. Rated M. Graphic Slash. Don't like, please don't read.
Criminal Minds - Rated: M - English - Chapters: 1 - Words: 3,249 - Reviews: 10 - Favs: 58 - Follows: 12 - Published: 11/16/2009 - S. Reid, Ethan - Complete
iNeed To Hit Something by White Firebird reviews
Oneshot. A look at some of the times where Sam needs to hit something and Freddie just happens to be right there, a ready and willing target.
iCarly - Rated: T - English - Friendship/Humor - Chapters: 1 - Words: 2,347 - Reviews: 14 - Favs: 29 - Follows: 4 - Published: 11/11/2009 - Sam P., Freddie B. - Complete
Fake smiles by RaexBB4eva reviews
Beast boy starts showing Raven how he feels about her but when Raven slowly starts to fall in love with Our beloved Beast Boy things take a turn for the worse and some of Beast Boys past raises.
Teen Titans - Rated: M - English - Supernatural/Mystery - Chapters: 1 - Words: 281 - Reviews: 4 - Favs: 3 - Follows: 5 - Published: 11/11/2009 - Beast Boy
Not An Act by Linables reviews
Coraline and Wybie have a choice of what to pay attention to: the terrible movie, or each other. To them, the choice was obvious. WxC lemon-scented oneshot, based on a mini-comic I wrote. C: Link inside!
Coraline - Rated: M - English - Romance - Chapters: 1 - Words: 5,156 - Reviews: 48 - Favs: 222 - Follows: 45 - Published: 11/10/2009 - Coraline J., Wybie L. - Complete
I cant do anything about it by my perspective reviews
Not the fact that I was being controlled by an even less human part of me. Or that I nearly killed my best friend. Or even the fact that this beast still lives inside of me. No. What scares me the most is that I can’t do anything about it. BB/Rae.
Teen Titans - Rated: T - English - Angst/Tragedy - Chapters: 1 - Words: 776 - Reviews: 8 - Favs: 9 - Follows: 1 - Published: 11/10/2009 - Beast Boy, Raven - Complete
It Was the Blonde, Unruly Hair by Apparently Awesome reviews
Freddie remembers things leading up to an important moment in his and Sam's life.
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 10 - Words: 15,441 - Reviews: 67 - Favs: 43 - Follows: 22 - Updated: 11/8/2009 - Published: 9/20/2009 - Freddie B., Sam P. - Complete
i'M Pregnant by x0xkorzx0x reviews
Plot: Sam discovers she is pregnant and Freddie is the father. How will Freddie react! SEDDIE
iCarly - Rated: T - English - Friendship/Romance - Chapters: 10 - Words: 7,664 - Reviews: 174 - Favs: 72 - Follows: 70 - Updated: 11/8/2009 - Published: 7/24/2009 - Sam P., Freddie B.
IAmFamous by FaithfullyHopefulxx reviews
Freddie has a secret. A big secret. That if anyone knew his whole life would probably change. His secret, he’s actually the super hot, lead singer of ‘Fresh’. The hottest band out. So what happens when Sam finds out?
iCarly - Rated: T - English - Romance/Humor - Chapters: 14 - Words: 17,182 - Reviews: 104 - Favs: 94 - Follows: 48 - Updated: 11/7/2009 - Published: 10/12/2009 - Freddie B., Sam P. - Complete
Perfection by freddiebenson reviews
Sam Puckett underestimated how satisfying starvation could be or how twisted the mind can become.
iCarly - Rated: T - English - Drama/Romance - Chapters: 9 - Words: 5,916 - Reviews: 57 - Favs: 15 - Follows: 32 - Updated: 11/6/2009 - Published: 9/7/2009 - Sam P., Freddie B.
What's Left Of Me by Tribble Master reviews
Shaggy gets stranded on another hunt. Luckily he has something to help him pass the time by. drug use, and death.
Scooby Doo - Rated: M - English - Angst/Horror - Chapters: 1 - Words: 734 - Reviews: 9 - Favs: 18 - Follows: 2 - Published: 11/1/2009 - Shaggy, Scooby Doo - Complete
iHate Scary Movies by musicfreak291 reviews
It's Halloween Night and the group doesn't know what to do. They decide to watch a horror movie but things start to become weird. Can Sam and Freddie escape the terror? Slight Seddie. One-shot.
iCarly - Rated: T - English - Horror/Supernatural - Chapters: 1 - Words: 2,197 - Reviews: 19 - Favs: 24 - Follows: 6 - Published: 10/31/2009 - Freddie B., Sam P.
iHit A Girl by LuDiamonds reviews
When Freddie snaps after Sam pushes him too far one day, he discovers a very...interesting secret about her.
iCarly - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 3,323 - Reviews: 49 - Favs: 122 - Follows: 13 - Published: 10/30/2009 - Freddie B., Sam P. - Complete
Nightmares, Version 2 by littlebixuit reviews
It seems that a strange add of Halloween and Full Moon awakes something they all thought to be defeated in Shaggy again. Kinda a sequel to Nightmares, but can be read separated. Contains blood violence. 'Most Graphic Horror Fic in '09 Halloween contest'
Scooby Doo - Rated: T - English - Angst/Horror - Chapters: 1 - Words: 3,038 - Reviews: 14 - Favs: 24 - Follows: 6 - Published: 10/30/2009 - Shaggy, Velma - Complete
Happy by hardly-noticeable reviews
The title will make since once it's finished. BB&Rae all the way. Rated for swearing and sexual content. Don't read if you don't like.
Teen Titans - Rated: M - English - Romance/Hurt/Comfort - Chapters: 4 - Words: 18,812 - Reviews: 40 - Favs: 120 - Follows: 24 - Updated: 10/30/2009 - Published: 10/19/2009 - Beast Boy, Raven - Complete
Excerpts from the blog of Fredward Benson by teasers reviews
The major events in the life of Fredward Benson. New first chapters up, so hope you'll check it out! Freddie/OC at the beginning. Future Fic. Rated T for death.
iCarly - Rated: T - English - Chapters: 19 - Words: 15,514 - Reviews: 18 - Favs: 3 - Follows: 3 - Updated: 10/30/2009 - Published: 9/27/2009 - Freddie B.
iHave Changed by x0xkorzx0x reviews
Taylor Lovato aka Sam Puckett is taken back to Seattle by her mum along with her sister Selena. She doesn't want to go back as she hasn't spoken to Carly or Freddie for ages and scared of what they will think of. Chapter 1 Sam's POV!More Inside. Seddie
iCarly - Rated: T - English - Romance/Friendship - Chapters: 39 - Words: 37,966 - Reviews: 105 - Favs: 39 - Follows: 25 - Updated: 10/30/2009 - Published: 5/10/2009 - Sam P., Freddie B. - Complete
Dance Like a Man by Downfall-of-Paris108 reviews
Everyone knows that Moose is an amazing dancer, but can he teach?
Step Up - Rated: T - English - Humor - Chapters: 2 - Words: 1,306 - Reviews: 9 - Favs: 24 - Follows: 7 - Updated: 10/19/2009 - Published: 9/3/2009 - Complete
Beastboy's Favor Raven's Price by VoiceintheShadows reviews
Beastboy asks Raven for a favor, but what is it? And what will Raven ask for in return? A bbrae story. Rated T for some language and slightly disturbing ideas. Disclaimer: I own nothing, so the world goes on.
Teen Titans - Rated: T - English - Romance - Chapters: 1 - Words: 1,906 - Reviews: 25 - Favs: 69 - Follows: 4 - Published: 10/19/2009 - Raven, Beast Boy - Complete
Falling Apart by aBeautifulLiar reviews
Ignore the way her body shakes, pretend you don't see the tears running down her pale face. Look away from her when you see the protuding bones, try and act like you don't see any of it. Try and act like you don't love her; even if it's what she needs.
iCarly - Rated: T - English - Angst/Tragedy - Chapters: 1 - Words: 582 - Reviews: 15 - Favs: 25 - Follows: 4 - Published: 10/16/2009 - Sam P., Freddie B. - Complete
iRebel by freddiebenson reviews
Freddie is hurt in a motorcycle accident, and Sam & Carly try to help. Seddie/Creddie.
iCarly - Rated: T - English - Romance/Drama - Chapters: 1 - Words: 668 - Reviews: 12 - Favs: 13 - Follows: 13 - Published: 10/15/2009 - Freddie B., Sam P.
Our Tortures by moonshowers reviews
This is my first story! The Teen Titans get captured, each put in their own separate torture cell. Will they ever get out! Read on to find out. Some BBxRae action. Rated T for violence
Teen Titans - Rated: T - English - Friendship/Angst - Chapters: 8 - Words: 6,973 - Reviews: 22 - Favs: 28 - Follows: 13 - Updated: 10/15/2009 - Published: 10/7/2009 - Beast Boy, Raven - Complete
Gone But Never Forgotten by Ghostwriter reviews
During an assignment, Derek learns something shocking about Casey's past. Mentions of child abuse.
Life With Derek - Rated: K+ - English - Chapters: 1 - Words: 680 - Reviews: 6 - Favs: 18 - Follows: 4 - Published: 10/15/2009 - Complete
iWill Take It to the Grave by xa-thousand-milesx reviews
Carly asks Freddie to pick Sam up from the dentist. But she has some secrets for him too... now, a xSeddiex TWOshot.
iCarly - Rated: K+ - English - Romance/Humor - Chapters: 2 - Words: 1,631 - Reviews: 49 - Favs: 74 - Follows: 11 - Updated: 10/11/2009 - Published: 9/19/2009 - Sam P., Freddie B. - Complete
Wait For Me by D0omkitty reviews
Beast Boy leaves. When he comes back has Aqualad stolen his girl's heart! Will Cyborg ever see his love again! Plus a new threat? Sequal to 'Sister' Enter for the results of terrible desions, new villans, a strange power... Hold Your Flames For the End :
Teen Titans - Rated: T - English - Romance/Drama - Chapters: 9 - Words: 16,122 - Reviews: 42 - Favs: 21 - Follows: 22 - Updated: 10/9/2009 - Published: 8/29/2007 - Beast Boy, Raven
I Miss You, Daddy by aBeautifulLiar reviews
It was that time of the year again - the time of year when Sam would come in, her eyes glued to the ground, her eyes red and the insults worse than ever. But this year was different, because she had fallen in love and insults never come easy then. Seddie
iCarly - Rated: T - English - Romance/Tragedy - Chapters: 4 - Words: 3,203 - Reviews: 31 - Favs: 28 - Follows: 9 - Updated: 10/8/2009 - Published: 9/27/2009 - Sam P., Freddie B. - Complete
Disturbed by Link131 reviews
I try to deny what's happening. I know though, and I watch her fade away. Rating it T now, will change it if it goes into M category...
iCarly - Rated: T - English - Angst/Romance - Chapters: 2 - Words: 1,956 - Reviews: 5 - Favs: 4 - Follows: 5 - Updated: 10/8/2009 - Published: 10/1/2009 - Freddie B., Sam P.
iElevator by Silence-Golden.DuctTape-Silver reviews
Freddie and Sam are on their way up to the 3rd floor when the elevator breaks down. One shot seddie. Sorry - it's not a very imaginative storyline
iCarly - Rated: K - English - Romance/Hurt/Comfort - Chapters: 1 - Words: 3,120 - Reviews: 8 - Favs: 34 - Follows: 4 - Published: 10/6/2009 - Freddie B., Sam P. - Complete
You're Not the Boss of Me Anymore by Dude Your Awesome8 reviews
BBxRae, One-Shot; The Doom Patrol comes for a visit to talk to Beast Boy about something he'd never think about until he was older. What will the Doom Patrol tell him, and will it be something really important?
Teen Titans - Rated: K+ - English - Family - Chapters: 1 - Words: 6,119 - Reviews: 21 - Favs: 59 - Follows: 15 - Published: 10/6/2009 - Beast Boy, Raven - Complete
iMight Have Been Raped by TohruROX2221 reviews
Pairings are Seddie and Cenji. Sam gets raped by a man on a double date with Freddie and Carly and Benji. What happens when the raping leaves her pregnant? Obviously T.
iCarly - Rated: T - English - Hurt/Comfort/Friendship - Chapters: 5 - Words: 6,617 - Reviews: 65 - Favs: 24 - Follows: 19 - Updated: 10/5/2009 - Published: 4/10/2009 - Sam P., Freddie B.
Igo away for six months by Mexicana1996 reviews
what if Freddie would have accepted the school cruise instead of giving it to Missy? What if he tried getting together with Sam but she doesnt believe in long distance relationships?But what will happen when he comes back and has a surprise?
iCarly - Rated: K+ - English - Romance/Friendship - Chapters: 4 - Words: 2,140 - Reviews: 9 - Favs: 9 - Follows: 10 - Updated: 10/3/2009 - Published: 7/24/2009 - Freddie B., Sam P.
PLEASE DON'T GO by agentmatt reviews
Freddie Saves Sam's Life Freddie B. & Sam P.
iCarly - Rated: K+ - English - Romance/Hurt/Comfort - Chapters: 3 - Words: 2,210 - Reviews: 10 - Favs: 8 - Follows: 1 - Updated: 10/1/2009 - Published: 9/29/2009 - Freddie B., Sam P.
I'm SO by SELena 21 reviews
....what if Sam has a diary and A certain dork found out and read it? what will happen? P.S. if you dont like it i'm sorry it's my first fanfic.
iCarly - Rated: K - English - Romance/Drama - Chapters: 4 - Words: 1,746 - Reviews: 5 - Favs: 4 - Follows: 3 - Published: 10/1/2009 - Freddie B., Sam P.
Water Phobia by Amythest Rose reviews
Raven has a secret phobia for water. What happens when the titans go to the beach and Beast Boy goes too far?
Teen Titans - Rated: T - English - Friendship/Hurt/Comfort - Chapters: 9 - Words: 5,061 - Reviews: 35 - Favs: 50 - Follows: 17 - Updated: 9/30/2009 - Published: 9/20/2009 - Raven, Beast Boy - Complete
on a highway to nowhere by ShatteredDiamonds reviews
- "I bite my lower lip to keep from screaming, because sometimes, keeping silent is the hardest thing of all. I want to stop feeling like I'm drowing, like the world's tipping on its axis. I just want my old life back." Freddie x Sam.
iCarly - Rated: T - English - Tragedy/Angst - Chapters: 8 - Words: 8,296 - Reviews: 32 - Favs: 11 - Follows: 17 - Updated: 9/29/2009 - Published: 6/7/2009 - Sam P., Freddie B.
iBelly Dance by Half-elf reviews
It's the summer before senior year and Mrs. Benson is looking for something to make Freddie's leaving for college easier. But it's when she drags Carly and Sam into it that things get interesting.
iCarly - Rated: T - English - Romance/Humor - Chapters: 1 - Words: 4,016 - Reviews: 16 - Favs: 43 - Follows: 5 - Published: 9/29/2009 - [Freddie B., Sam P.] - Complete
iSnapshot by dork-with-glasses reviews
All it takes is one second, one glance, one 'snapshot' of a moment and suddenly your life changes forever. And holy ham it's happened to me. And sometimes the 'snapshot' is too much.....Sam's thoughts at the end of iSpeed Date
iCarly - Rated: K+ - English - Romance/Friendship - Chapters: 1 - Words: 570 - Reviews: 6 - Favs: 15 - Follows: 1 - Published: 9/27/2009 - Sam P., Freddie B. - Complete
It All Started This Summer by Clair-Crossed reviews
There has always been this sort of tension between them. When Sam and Freddie go to a party, and both make a bet with their friends things go a little wild. Or is it really a bet? Rated M
iCarly - Rated: M - English - Humor/Romance - Chapters: 13 - Words: 14,805 - Reviews: 96 - Favs: 48 - Follows: 67 - Updated: 9/26/2009 - Published: 5/29/2009 - Freddie B., Sam P.
30 Ways to Know If You're Obbsessed with BBxRae! by xXNevermoreAgainXx reviews
Are YOU a true BBxRae fan? Let's find out, shall we? x3
Teen Titans - Rated: K - English - Humor - Chapters: 1 - Words: 436 - Reviews: 144 - Favs: 94 - Follows: 7 - Published: 9/23/2009 - Beast Boy, Raven - Complete
Drunken Dilemma by fanaticwr1t3r reviews
After Raven and BB decide to go out as 'Friends'... or so they tell themselves... they go to a Bar to avoid the Paparazzi. But at what cost? Their sobriety and Raven's virginity, o'coarse! And it's even worse when they find out it wasn't safe sex! BBxRae
Teen Titans - Rated: T - English - Drama - Chapters: 13 - Words: 27,580 - Reviews: 60 - Favs: 46 - Follows: 27 - Updated: 9/21/2009 - Published: 10/16/2008 - Beast Boy, Raven - Complete
Did You Like It? by moeexyz reviews
Post iThink They Kissed . "Yeah" Carly began, "Did you, you know...like it?" Seddie. ONESHOT.
iCarly - Rated: K+ - English - Romance - Chapters: 1 - Words: 816 - Reviews: 15 - Favs: 31 - Follows: 1 - Published: 9/18/2009 - Sam P., Freddie B. - Complete
Scared to Death! by xXNevermoreAgainXx reviews
And Beast Boy always thought it was just a saying.
Teen Titans - Rated: T - English - Humor - Chapters: 1 - Words: 903 - Reviews: 32 - Favs: 47 - Follows: 3 - Published: 9/18/2009 - Beast Boy, Raven - Complete
Bruises by xXACCEBXx reviews
She's never realized what she's been doing to him until now. But maybe she can still fix it. SEDDIE.
iCarly - Rated: T - English - Romance/Angst - Chapters: 1 - Words: 1,313 - Reviews: 48 - Favs: 111 - Follows: 11 - Published: 9/16/2009 - Freddie B., Sam P. - Complete
iKnow This Devastation by D R O W N-I N-S E Q U I N S reviews
He watches as she angrily begins smacking the pictures and letters back on the locker but she doesn’t have any tape and she bursts into tears as they fall around her feet. Oneshot. Dark Seddie.
iCarly - Rated: T - English - Angst/Romance - Chapters: 1 - Words: 6,804 - Reviews: 67 - Favs: 95 - Follows: 5 - Published: 9/16/2009 - Sam P., Freddie B. - Complete
iWon't Be Seventeen Forever by LuDiamonds reviews
Sam wakes up beside Freddie after a night of hardcore partying with no memory of what happened at all. Soon, something starts to happen within her. Something that will change her and Freddie's life forever.
iCarly - Rated: T - English - Romance/Humor - Chapters: 20 - Words: 43,345 - Reviews: 631 - Favs: 356 - Follows: 160 - Updated: 9/16/2009 - Published: 6/9/2009 - Sam P., Freddie B. - Complete